SitesBLAST
Comparing CCNA_02288 FitnessBrowser__Caulo:CCNA_02288 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8DLI5 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1) (see paper)
37% identity, 97% coverage: 1:272/279 of query aligns to 1:271/485 of Q8DLI5
- R6 (= R6) binding
- Y192 (= Y193) binding
2cfoA Non-discriminating glutamyl-tRNA synthetase from thermosynechococcus elongatus in complex with glu (see paper)
37% identity, 97% coverage: 2:272/279 of query aligns to 1:270/484 of 2cfoA
P04805 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Escherichia coli (strain K12) (see 4 papers)
34% identity, 95% coverage: 1:266/279 of query aligns to 1:254/471 of P04805
- C98 (= C98) mutation to S: 10-fold decrease in activity. Strong decrease in zinc content.
- C100 (≠ K100) mutation to S: Loss of activity. Strong decrease in zinc content.; mutation to Y: Does not prevent zinc binding. Reduces only 2-fold the binding affinity for tRNA(Glu), but reduces more than 10-fold the affinity for glutamate in the presence of tRNA(Glu).
- C125 (≠ A125) mutation to S: Loss of activity. Strong decrease in zinc content.
- H127 (≠ E127) mutation to Q: 10-fold decrease in activity. Strong decrease in zinc content.
- H129 (≠ A129) mutation to Q: No change in activity or in zinc content.
- H131 (≠ R131) mutation to Q: No change in activity or in zinc content.
- H132 (≠ L132) mutation to Q: No change in activity or in zinc content.
- C138 (≠ F138) mutation to S: No change in activity or in zinc content.
- S239 (≠ A251) modified: Phosphoserine; mutation to D: Does not aminoacylate tRNA(Glu), not phosphorylated by HipA.
1g59A Glutamyl-tRNA synthetase complexed with tRNA(glu). (see paper)
36% identity, 99% coverage: 4:279/279 of query aligns to 3:276/468 of 1g59A
- binding : D44 (= D45), R45 (≠ A46), A46 (≠ T47), R47 (= R48), P109 (≠ R102), V145 (≠ A139), R163 (≠ D165), V166 (≠ S168), E172 (≠ A174), V177 (= V183), K180 (≠ R186), S181 (≠ K187), D182 (= D188), E207 (= E213), E208 (≠ D214), R237 (≠ T243), K241 (≠ G247), T242 (≠ K248), K243 (≠ R249), M273 (vs. gap), G274 (= G277)
Sites not aligning to the query:
- binding : 282, 299, 300, 303, 304, 309, 312, 319, 357, 358, 417, 426, 427, 432, 435, 442, 443, 444, 445, 446, 447, 448
2cv2A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu) and an enzyme inhibitor, glu-ams (see paper)
36% identity, 99% coverage: 4:279/279 of query aligns to 3:276/468 of 2cv2A
- active site: K246 (= K252)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R5 (= R6), A7 (= A8), S9 (= S10), G17 (= G18), I21 (≠ S22), E41 (= E42), Y187 (= Y193), R205 (= R211), A206 (≠ G212), E208 (≠ D214), W209 (≠ L215), L235 (= L241), L236 (= L242)
- binding : S9 (= S10), T43 (≠ I44), D44 (= D45), R47 (= R48), V145 (≠ A139), R163 (≠ D165), Y168 (≠ R170), E172 (≠ A174), V177 (= V183), K180 (≠ R186), S181 (≠ K187), Y187 (= Y193), E207 (= E213), E208 (≠ D214), W209 (≠ L215), V211 (≠ E217), R237 (≠ T243), K241 (≠ G247), L272 (vs. gap), M273 (vs. gap), G274 (= G277)
Sites not aligning to the query:
- binding : 282, 299, 303, 304, 309, 312, 319, 357, 358, 417, 432, 435, 442, 443, 444, 446, 447, 448
2cv1A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu), atp, and an analog of l-glutamate: a quaternary complex
36% identity, 99% coverage: 4:279/279 of query aligns to 3:276/468 of 2cv1A
- active site: K246 (= K252)
- binding adenosine-5'-triphosphate: P8 (= P9), S9 (= S10), G17 (= G18), T18 (≠ H19), I21 (≠ S22), R47 (= R48), A206 (≠ G212), W209 (≠ L215), L235 (= L241), L236 (= L242)
- binding (4s)-4-amino-5-hydroxypentanoic acid: R5 (= R6), A7 (= A8), E41 (= E42), Y187 (= Y193), R205 (= R211), W209 (≠ L215)
- binding : S9 (= S10), E41 (= E42), T43 (≠ I44), D44 (= D45), R47 (= R48), V145 (≠ A139), R163 (≠ D165), V166 (≠ S168), E172 (≠ A174), V177 (= V183), K180 (≠ R186), S181 (≠ K187), Y187 (= Y193), E207 (= E213), E208 (≠ D214), W209 (≠ L215), V211 (≠ E217), R237 (≠ T243), K241 (≠ G247), K243 (≠ R249), M273 (vs. gap), G274 (= G277), S276 (= S279)
Sites not aligning to the query:
- binding : 282, 299, 303, 304, 309, 312, 319, 357, 358, 417, 427, 432, 435, 442, 443, 444, 446, 447, 448
2cuzA Glutamyl-tRNA synthetase from thermus thermophilus in complex with l-glutamate (see paper)
36% identity, 99% coverage: 4:279/279 of query aligns to 3:276/468 of 2cuzA
1n78A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with tRNA(glu) and glutamol-amp. (see paper)
36% identity, 99% coverage: 4:279/279 of query aligns to 3:276/468 of 1n78A
- active site: K246 (= K252)
- binding glutamol-amp: R5 (= R6), A7 (= A8), P8 (= P9), S9 (= S10), G17 (= G18), T18 (≠ H19), I21 (≠ S22), E41 (= E42), Y187 (= Y193), N191 (≠ V197), R205 (= R211), A206 (≠ G212), E208 (≠ D214), W209 (≠ L215), L235 (= L241), L236 (= L242)
- binding : S9 (= S10), T43 (≠ I44), D44 (= D45), R47 (= R48), V145 (≠ A139), R163 (≠ D165), V166 (≠ S168), Y168 (≠ R170), E172 (≠ A174), V177 (= V183), K180 (≠ R186), S181 (≠ K187), Y187 (= Y193), E207 (= E213), E208 (≠ D214), W209 (≠ L215), L210 (≠ F216), V211 (≠ E217), R237 (≠ T243), K241 (≠ G247), M273 (vs. gap), G274 (= G277)
Sites not aligning to the query:
- binding : 282, 297, 303, 304, 309, 312, 319, 357, 358, 417, 427, 432, 435, 442, 443, 444, 446, 447, 448
1j09A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with atp and glu (see paper)
36% identity, 99% coverage: 4:279/279 of query aligns to 3:276/468 of 1j09A
- active site: K246 (= K252)
- binding adenosine-5'-triphosphate: H15 (= H16), E208 (≠ D214), L235 (= L241), L236 (= L242), K243 (≠ R249), I244 (≠ Y250), S245 (≠ A251), K246 (= K252), R247 (= R253)
- binding glutamic acid: R5 (= R6), A7 (= A8), S9 (= S10), E41 (= E42), Y187 (= Y193), N191 (≠ V197), R205 (= R211), W209 (≠ L215)
P27000 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
36% identity, 99% coverage: 4:279/279 of query aligns to 3:276/468 of P27000
Sites not aligning to the query:
- 358 R→Q: Reduces affinity for tRNA and abolishes the ability to discriminate between tRNA(Glu) and tRNA(Gln).
8i9iA Glutamyl-tRNA synthetase from escherichia coli bound to glutamate and zinc
33% identity, 95% coverage: 1:266/279 of query aligns to 1:254/468 of 8i9iA
P27305 Glutamyl-Q tRNA(Asp) synthetase; Glu-Q-RSs; EC 6.1.1.- from Escherichia coli (strain K12) (see paper)
35% identity, 92% coverage: 3:259/279 of query aligns to 16:248/308 of P27305
- E55 (= E42) binding
- Y182 (= Y193) binding
- R200 (= R211) binding
4g6zA Crystal structure of a glutamyl-tRNA synthetase glurs from burkholderia thailandensis bound to l-glutamate (see paper)
33% identity, 99% coverage: 5:279/279 of query aligns to 5:255/380 of 4g6zA
4a91A Crystal structure of the glutamyl-queuosine trnaasp synthetase from e. Coli complexed with l-glutamate (see paper)
35% identity, 91% coverage: 3:256/279 of query aligns to 4:233/290 of 4a91A
- active site: S11 (= S10), K229 (= K252)
- binding glutamic acid: R7 (= R6), A9 (= A8), S11 (= S10), E43 (= E42), Y170 (= Y193), R188 (= R211), L192 (= L215)
- binding zinc ion: C99 (= C98), C101 (≠ K100), Y113 (vs. gap), C117 (vs. gap)
3al0C Crystal structure of the glutamine transamidosome from thermotoga maritima in the glutamylation state. (see paper)
32% identity, 96% coverage: 5:272/279 of query aligns to 105:355/564 of 3al0C
- active site: S110 (= S10), K335 (= K252)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R106 (= R6), A108 (= A8), P109 (= P9), G118 (= G18), T122 (≠ S22), E142 (= E42), Y276 (= Y193), R294 (= R211), G295 (= G212), D297 (= D214), H298 (≠ L215), L324 (= L241), I325 (≠ L242), L333 (≠ Y250)
- binding : T144 (≠ I44), D145 (= D45), R148 (= R48), Y208 (= Y96), P213 (≠ T101), K252 (vs. gap), M255 (≠ L160), I266 (≠ V183), K269 (≠ R186), S270 (≠ K187), Y276 (= Y193), D297 (= D214), H298 (≠ L215), L299 (≠ F216), S300 (≠ E217), N301 (≠ A218), K304 (≠ I221), R330 (≠ G247), P332 (≠ R249)
Sites not aligning to the query:
- binding : 363, 364, 365, 370, 387, 389, 391, 392, 397, 400, 407, 446, 447, 453, 457, 509, 520, 524, 527, 535, 536, 538, 539
4griB Crystal structure of a glutamyl-tRNA synthetase glurs from borrelia burgdorferi bound to glutamic acid and zinc (see paper)
30% identity, 94% coverage: 5:266/279 of query aligns to 4:267/485 of 4griB
- active site: S9 (= S10), K253 (= K252)
- binding glutamic acid: R5 (= R6), A7 (= A8), S9 (= S10), E41 (= E42), Y194 (= Y193), R212 (= R211), W216 (≠ L215)
- binding zinc ion: C105 (= C98), C107 (vs. gap), Y128 (≠ I116), C132 (≠ G120)
8vc5A Crystal structure of glutamyl-tRNA synthetase glurs from pseudomonas aeruginosa (zinc bound)
33% identity, 99% coverage: 2:277/279 of query aligns to 3:279/488 of 8vc5A
6brlA Crystal structure of a glutamate tRNA ligase from elizabethkingia meningosepticum ccug26117 in complex with its amino acid
31% identity, 90% coverage: 5:254/279 of query aligns to 5:263/502 of 6brlA
3aiiA Archaeal non-discriminating glutamyl-tRNA synthetase from methanothermobacter thermautotrophicus (see paper)
34% identity, 86% coverage: 4:242/279 of query aligns to 12:232/455 of 3aiiA
Sites not aligning to the query:
2re8A Glutaminyl-tRNA synthetase mutant c229r with bound analog 5'-o-[n-(l- glutamyl)-sulfamoyl]adenosine (see paper)
38% identity, 34% coverage: 2:96/279 of query aligns to 19:113/529 of 2re8A
Sites not aligning to the query:
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: 204, 208, 222, 223, 253, 254, 263
- binding : 6, 117, 119, 123, 126, 128, 129, 161, 174, 175, 176, 182, 185, 203, 204, 226, 228, 306, 309, 310, 311, 313, 314, 316, 319, 322, 329, 334, 362, 363, 392, 394, 395, 403, 405, 406, 435, 499, 501, 502, 527
Query Sequence
>CCNA_02288 FitnessBrowser__Caulo:CCNA_02288
MTFVTRFAPSPTGYLHRGHAYSALTAFEAARVTGGRFLLRIEDIDATRCRPEYEAAILED
LAWLGLNWEAPVRRQSEHLADYEAAIAGLRDRGLVYRCFKTRKEIDIGRAPHEPAIAYVG
APLGADEEAQRLARGEPFAWRLSLAAAREALGGFDHLSFLEEGADGSSPRTVQALPETAG
DIVLARKDVGVAYHLAVVHDDALQGVTHVIRGEDLFEATHIQRLLQALLGLPTPIYRHHG
LLTGPDGKRYAKRDKAQTLRELRASGVSAQDLRAELGFS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory