Comparing CCNA_02296 FitnessBrowser__Caulo:CCNA_02296 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4xg1B Psychromonas ingrahamii diaminopimelate decarboxylase with llp
45% identity, 97% coverage: 2:411/421 of query aligns to 1:409/418 of 4xg1B
B4XMC6 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Helicobacter pylori (Campylobacter pylori) (see paper)
41% identity, 91% coverage: 27:411/421 of query aligns to 13:394/405 of B4XMC6
3c5qA Crystal structure of diaminopimelate decarboxylase (i148l mutant) from helicobacter pylori complexed with l-lysine
42% identity, 91% coverage: 27:411/421 of query aligns to 11:386/394 of 3c5qA
4xg1A Psychromonas ingrahamii diaminopimelate decarboxylase with llp
42% identity, 97% coverage: 2:411/421 of query aligns to 1:384/393 of 4xg1A
Q58497 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
39% identity, 96% coverage: 14:418/421 of query aligns to 21:434/438 of Q58497
1twiA Crystal structure of diaminopimelate decarboxylase from m. Jannaschii in co-complex with l-lysine (see paper)
39% identity, 96% coverage: 14:418/421 of query aligns to 17:430/434 of 1twiA
1tufA Crystal structure of diaminopimelate decarboxylase from m. Jannaschi (see paper)
39% identity, 96% coverage: 14:418/421 of query aligns to 17:430/434 of 1tufA
6n2aA Meso-diaminopimelate decarboxylase from arabidopsis thaliana (isoform 1)
36% identity, 95% coverage: 11:412/421 of query aligns to 13:416/422 of 6n2aA
Q9X1K5 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
35% identity, 93% coverage: 18:407/421 of query aligns to 4:376/386 of Q9X1K5
2yxxA Crystal structure analysis of diaminopimelate decarboxylate (lysa)
35% identity, 93% coverage: 18:407/421 of query aligns to 3:375/385 of 2yxxA
1knwA Crystal structure of diaminopimelate decarboxylase
34% identity, 93% coverage: 18:407/421 of query aligns to 16:409/421 of 1knwA
P00861 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Escherichia coli (strain K12)
34% identity, 93% coverage: 18:407/421 of query aligns to 17:410/420 of P00861
1ko0A Crystal structure of a d,l-lysine complex of diaminopimelate decarboxylase
34% identity, 93% coverage: 18:407/421 of query aligns to 16:409/419 of 1ko0A
5x7nA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
34% identity, 95% coverage: 15:413/421 of query aligns to 29:440/442 of 5x7nA
5x7mA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
34% identity, 95% coverage: 15:413/421 of query aligns to 29:440/443 of 5x7mA
P9WIU7 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
33% identity, 96% coverage: 10:413/421 of query aligns to 22:443/447 of P9WIU7
1hkvA Mycobacterium diaminopimelate dicarboxylase (lysa) (see paper)
33% identity, 96% coverage: 10:413/421 of query aligns to 21:442/446 of 1hkvA
7ru7A Crystal structure of btrk, a decarboxylase involved in butirosin biosynthesis
29% identity, 93% coverage: 27:416/421 of query aligns to 17:411/412 of 7ru7A
8d5rA Structure of y430f d-ornithine/d-lysine decarboxylase complex with d- ornithine (see paper)
29% identity, 98% coverage: 4:416/421 of query aligns to 23:456/461 of 8d5rA
8d5dA Structure of y430f d-ornithine/d-lysine decarboxylase complex with d- arginine (see paper)
29% identity, 98% coverage: 4:416/421 of query aligns to 22:454/458 of 8d5dA
>CCNA_02296 FitnessBrowser__Caulo:CCNA_02296
MNHFEYGPQGLACEGVPLAKIAAEVGTPVYVYSRATLERHFVVFRDALAMSGVVDPLIAY
AVKANSNVAVLKVLGDLGAGADTVSEGEVRRALAAGIPGERIVFSGVGKARREIAFALQA
GVAEINVESEPELNLIAEVAAELGVRAKVAFRVNPDVAAGGHAKIATGKSENKFGVSFAE
AARLYANASNNANLQPVGVACHIGSQITDLAPMRAAFTKMRGLVEQLLAEGLSVERLDLG
GGLGVPYFNHPEPPSPAEFAAMVGEVTQGLPVTLAFEPGRVIAANAGVLVSEVIHVHERP
EGRKFLVIDAAMNDLVRPAMYDAFHDIRPVIQRTGETVYDVVGPVCETGDTFTRDRALPP
FAAGDLVAFMSAGAYGAAMASEYNTRPLVPEVLVDGDRYAVIRQRPTYDEMLARDLVPDW
V
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory