Comparing CCNA_02307 FitnessBrowser__Caulo:CCNA_02307 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
4wjiA Crystal structure of cyclohexadienyl dehydrogenase from sinorhizobium meliloti in complex with NADP and tyrosine
57% identity, 94% coverage: 8:300/312 of query aligns to 4:293/293 of 4wjiA
3ggpA Crystal structure of prephenate dehydrogenase from a. Aeolicus in complex with hydroxyphenyl propionate and NAD+ (see paper)
36% identity, 83% coverage: 13:271/312 of query aligns to 10:263/286 of 3ggpA
3ggoA Crystal structure of prephenate dehydrogenase from a. Aeolicus with hpp and nadh (see paper)
36% identity, 83% coverage: 13:271/312 of query aligns to 10:263/285 of 3ggoA
3gggD The crystal structure of a. Aeolicus prephenate dehydrogenase in complex with tyrosine and NAD+ (see paper)
36% identity, 83% coverage: 13:271/312 of query aligns to 18:271/293 of 3gggD
5uyyA Crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with l-tyrosine (see paper)
32% identity, 91% coverage: 7:290/312 of query aligns to 8:287/373 of 5uyyA
Sites not aligning to the query:
6u60B Crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with NAD and l-tyrosine (see paper)
33% identity, 90% coverage: 10:290/312 of query aligns to 3:279/365 of 6u60B
Sites not aligning to the query:
3b1fA Crystal structure of prephenate dehydrogenase from streptococcus mutans (see paper)
29% identity, 91% coverage: 11:293/312 of query aligns to 9:285/286 of 3b1fA
2f1kA Crystal structure of synechocystis arogenate dehydrogenase (see paper)
28% identity, 90% coverage: 10:290/312 of query aligns to 2:274/279 of 2f1kA
2rirE Crystal structure of dipicolinate synthase, a chain, from bacillus subtilis
28% identity, 38% coverage: 10:127/312 of query aligns to 159:271/298 of 2rirE
Q04809 Dipicolinate synthase subunit A; DPA synthase subunit A; Spore dipicolinate synthase subunit A; Stage V sporulation protein FA; EC 1.3.1.- from Bacillus subtilis (strain 168)
28% identity, 38% coverage: 10:127/312 of query aligns to 156:268/297 of Q04809
>CCNA_02307 FitnessBrowser__Caulo:CCNA_02307
MPNPGVLYPKLTVIGCGLIGGSVIRAARQHGVVGEITVADASEAHRARVTELGIAEHVTG
DIAEAVKDADLVVIATPVLSVPELARVVIPAMKPGATLTDVGSTKGNVAEAFRAQDLSKI
FAIPGHPIAGTEQSGPDAGFAELFENRWTILTPFESEDDHYAAAVAKLSAFWRAFGAQVE
LMDDKHHDLVLAVVSHLPHLIAYTIVGSAADLENVTENEVIKYSASGFRDFTRIAASDPT
MWRDIFVANKDAVLEMLGRFTEDLQAMSRAIRWGDADTLHAHFTRTRAIRRGIVAAGQES
AEPNFGRDRGKH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory