SitesBLAST
Comparing CCNA_02347 FitnessBrowser__Caulo:CCNA_02347 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2h5aX Complex of the enzyme pmm/pgm with xylose 1-phosphate (see paper)
29% identity, 93% coverage: 22:484/498 of query aligns to 1:445/455 of 2h5aX
- active site: H101 (= H122), D234 (= D259), D236 (= D261), D238 (= D263), R239 (= R264), D332 (= D360)
- binding 1-O-phosphono-alpha-D-xylopyranose: Y9 (= Y30), T298 (= T325), G299 (= G326), H300 (= H327), E317 (= E344), S319 (= S346), H321 (= H348), R413 (= R454), S415 (= S456), N416 (≠ S457), T417 (≠ N458)
- binding zinc ion: S100 (= S121), D234 (= D259), D236 (= D261), D238 (= D263)
2h4lX Complex of pmm/pgm with ribose 1-phosphate (see paper)
29% identity, 93% coverage: 22:484/498 of query aligns to 1:445/455 of 2h4lX
- active site: H101 (= H122), D234 (= D259), D236 (= D261), D238 (= D263), R239 (= R264), D332 (= D360)
- binding 1-O-phosphono-alpha-D-ribofuranose: Y9 (= Y30), R12 (= R33), S100 (= S121), T298 (= T325), E317 (= E344), R413 (= R454), S415 (= S456), N416 (≠ S457), T417 (≠ N458)
- binding zinc ion: S100 (= S121), D234 (= D259), D236 (= D261), D238 (= D263)
2fkfA Phosphomannomutase/phosphoglucomutase from pseudomonas aeruginosa with alpha-d-glucose 1,6-bisphosphate bound (see paper)
29% identity, 93% coverage: 22:484/498 of query aligns to 1:445/455 of 2fkfA
- active site: R12 (= R33), S100 (= S121), H101 (= H122), K110 (= K131), D234 (= D259), D236 (= D261), D238 (= D263), R239 (= R264), H321 (= H348), D332 (= D360)
- binding 1,6-di-O-phosphono-alpha-D-glucopyranose: R7 (= R28), H101 (= H122), S319 (= S346), R413 (= R454), S415 (= S456), N416 (≠ S457), T417 (≠ N458)
- binding zinc ion: S100 (= S121), D234 (= D259), D236 (= D261), D238 (= D263)
1pcmX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
29% identity, 93% coverage: 22:484/498 of query aligns to 1:445/455 of 1pcmX
- active site: R12 (= R33), S100 (= S121), H101 (= H122), K110 (= K131), D234 (= D259), D236 (= D261), D238 (= D263), R239 (= R264), H321 (= H348), D332 (= D360)
- binding 6-O-phosphono-alpha-D-mannopyranose: Y9 (= Y30), S100 (= S121), T298 (= T325), G299 (= G326), H300 (= H327), E317 (= E344), S319 (= S346), H321 (= H348), R413 (= R454), S415 (= S456)
- binding zinc ion: S100 (= S121), D234 (= D259), D236 (= D261), D238 (= D263)
1p5gX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
29% identity, 93% coverage: 22:484/498 of query aligns to 1:445/455 of 1p5gX
- active site: R12 (= R33), S100 (= S121), H101 (= H122), K110 (= K131), D234 (= D259), D236 (= D261), D238 (= D263), R239 (= R264), H321 (= H348), D332 (= D360)
- binding 6-O-phosphono-alpha-D-glucopyranose: Y9 (= Y30), S100 (= S121), K277 (= K302), G299 (= G326), H300 (= H327), E317 (= E344), S319 (= S346), H321 (= H348), R413 (= R454), S415 (= S456), N416 (≠ S457), T417 (≠ N458)
- binding zinc ion: S100 (= S121), D234 (= D259), D236 (= D261), D238 (= D263)
1p5dX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
29% identity, 93% coverage: 22:484/498 of query aligns to 1:445/455 of 1p5dX
- active site: R12 (= R33), S100 (= S121), H101 (= H122), K110 (= K131), D234 (= D259), D236 (= D261), D238 (= D263), R239 (= R264), H321 (= H348), D332 (= D360)
- binding 1-O-phosphono-alpha-D-glucopyranose: Y9 (= Y30), S100 (= S121), R239 (= R264), T298 (= T325), G299 (= G326), H300 (= H327), E317 (= E344), S319 (= S346), H321 (= H348), R413 (= R454), S415 (= S456), T417 (≠ N458)
- binding zinc ion: S100 (= S121), D234 (= D259), D236 (= D261), D238 (= D263)
P26276 Phosphomannomutase/phosphoglucomutase; PMM / PGM; EC 5.4.2.2; EC 5.4.2.8 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 10 papers)
29% identity, 93% coverage: 22:484/498 of query aligns to 9:453/463 of P26276
- R15 (= R28) mutation to A: KM halves, decreases processivity as dissociation of G1,6P intermediate increases 25-fold.
- Y17 (= Y30) binding ; binding
- R20 (= R33) mutation to A: No phosphoglucomutase activity.
- S108 (= S121) binding via phosphate group; modified: Phosphoserine; mutation S->A,V: About 5% activity, still subject to substrate inhibition and requires G1,6P as an activator; phosphorylation occurs at a different site.; mutation to C: KM for G1P unchanged, kcat decreases 24-fold; G1,6P stimulates reaction by 2-3 orders of magnitude. No stable protein phosphorylation detected, altered ligation of metal residue.
- N110 (= N123) mutation to A: KM halves, decreases processivity as dissociation of G1,6P intermediate increases 30-fold.
- D242 (= D259) binding
- D244 (= D261) binding
- D246 (= D263) binding
- R247 (= R264) mutation to A: Small reduction in KM, small increase in dissociation of G1,6P intermediate.
- R262 (≠ K279) mutation to A: Increases KM 2-fold, decreases kcat 9-fold for G1P. Alters flexibility of the hinge region.
- K285 (= K302) binding
- H308 (= H327) binding ; binding
- E325 (= E344) mutation to A: Reduces KM and Vmax approximately 2-fold.
- EMSGH 325:329 (≠ EKSGH 344:348) binding ; binding
- H329 (= H348) mutation to A: No phosphoglucomutase activity using G1P as substrate, protein is less easily phosphorylated, no significant change in structure.
- P368 (= P389) mutation to G: Increases KM 2-fold, decreases kcat 6-fold for G1P. Alters flexibility of the hinge region, structure is less compact.
- R421 (= R454) mutation to C: Loss of phosphomannomutase activity, very low phosphoglucomutase activity.
- RASNT 421:425 (≠ RASSN 454:458) binding ; binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
Q02E40 Phosphomannomutase/phosphoglucomutase; PMM / PGM; EC 5.4.2.2; EC 5.4.2.8 from Pseudomonas aeruginosa (strain UCBPP-PA14) (see paper)
29% identity, 93% coverage: 22:484/498 of query aligns to 9:453/463 of Q02E40
- S108 (= S121) active site, Non-phosphorylated intermediate; modified: Phosphoserine
1pcjX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
29% identity, 93% coverage: 22:484/498 of query aligns to 4:448/458 of 1pcjX
- active site: R15 (= R33), S103 (= S121), H104 (= H122), K113 (= K131), D237 (= D259), D239 (= D261), D241 (= D263), R242 (= R264), H324 (= H348), D335 (= D360)
- binding 1-O-phosphono-alpha-D-mannopyranose: Y12 (= Y30), S103 (= S121), T301 (= T325), G302 (= G326), E320 (= E344), S322 (= S346), H324 (= H348), R416 (= R454), S418 (= S456), N419 (≠ S457), T420 (≠ N458)
- binding zinc ion: S103 (= S121), D237 (= D259), D239 (= D261), D241 (= D263)
1k2yX Crystal structure of phosphomannomutase/phosphoglucomutase s108a mutant from p. Aeruginosa (see paper)
29% identity, 93% coverage: 22:484/498 of query aligns to 5:449/459 of 1k2yX
4il8A Crystal structure of an h329a mutant of p. Aeruginosa pmm/pgm (see paper)
29% identity, 93% coverage: 22:484/498 of query aligns to 5:449/459 of 4il8A
- active site: R16 (= R33), S104 (= S121), H105 (= H122), K114 (= K131), D238 (= D259), D240 (= D261), D242 (= D263), R243 (= R264), A325 (≠ H348), D336 (= D360)
- binding magnesium ion: S104 (= S121), D238 (= D259), D240 (= D261), D242 (= D263)
3rsmA Crystal structure of s108c mutant of pmm/pgm (see paper)
29% identity, 88% coverage: 48:484/498 of query aligns to 14:426/436 of 3rsmA
- active site: C87 (≠ S121), K91 (≠ T128), D215 (= D259), D217 (= D261), D219 (= D263), R220 (= R264), H302 (= H348), D313 (= D360)
- binding phosphate ion: C87 (≠ S121), D215 (= D259), D217 (= D261), D219 (= D263), R220 (= R264)
- binding zinc ion: D215 (= D259), D217 (= D261), D219 (= D263)
3uw2A X-ray crystal structure of phosphoglucomutase/phosphomannomutase family protein (bth_i1489)from burkholderia thailandensis (see paper)
30% identity, 92% coverage: 21:476/498 of query aligns to 1:444/458 of 3uw2A
- active site: R13 (= R33), S109 (= S121), H110 (= H122), K119 (= K131), D243 (= D259), D245 (= D261), D247 (= D263), R248 (= R264), H330 (= H348)
- binding zinc ion: D243 (= D259), D245 (= D261), D247 (= D263)
1wqaA Crystal structure of pyrococcus horikoshii phosphomannomutase/phosphoglucomutase complexed with mg2+
28% identity, 85% coverage: 48:472/498 of query aligns to 26:437/455 of 1wqaA
- active site: S101 (= S121), H102 (= H122), K111 (= K131), D243 (= D259), D245 (= D261), D247 (= D263), R248 (= R264), G330 (= G347), R340 (≠ Y359)
- binding magnesium ion: S101 (= S121), D243 (= D259), D245 (= D261), D247 (= D263)
Sites not aligning to the query:
6mlwA Crystal structure of x. Citri phosphoglucomutase in complex with 2- fluoro mannosyl-1-methyl-phosphonic acid (see paper)
28% identity, 89% coverage: 27:468/498 of query aligns to 7:429/449 of 6mlwA
- active site: R13 (= R33), S98 (= S121), H99 (= H122), K108 (= K131), D238 (= D259), D240 (= D261), D242 (= D263), R243 (= R264), H325 (= H348)
- binding 2,6-anhydro-5,7-dideoxy-5-fluoro-7-phosphono-D-glycero-D-manno-heptitol: G303 (= G326), H304 (= H327), E321 (= E344), S323 (= S346), H325 (= H348), R415 (= R454), S417 (= S456), N418 (≠ S457), T419 (≠ N458), R424 (≠ V463)
- binding magnesium ion: S98 (= S121), D238 (= D259), D240 (= D261), D242 (= D263)
5bmpA Crystal structure of phosphoglucomutase from xanthomonas citri complexed with glucose-1-phosphate (see paper)
28% identity, 89% coverage: 27:468/498 of query aligns to 7:429/449 of 5bmpA
- active site: R13 (= R33), S98 (= S121), H99 (= H122), K108 (= K131), D238 (= D259), D240 (= D261), D242 (= D263), R243 (= R264), H325 (= H348)
- binding 1-O-phosphono-alpha-D-glucopyranose: R281 (≠ K302), G303 (= G326), E321 (= E344), S323 (= S346), H325 (= H348), R415 (= R454), S417 (= S456), N418 (≠ S457), T419 (≠ N458), R424 (≠ V463)
- binding magnesium ion: S98 (= S121), D238 (= D259), D240 (= D261), D242 (= D263)
6nqhA Xanthomonas citri dephospho-pgm in complex with xylose-1-phosphate
28% identity, 89% coverage: 27:468/498 of query aligns to 6:428/448 of 6nqhA
- active site: R12 (= R33), S97 (= S121), H98 (= H122), K107 (= K131), D237 (= D259), D239 (= D261), D241 (= D263), R242 (= R264), H324 (= H348)
- binding magnesium ion: D237 (= D259), D239 (= D261), D241 (= D263)
- binding 1-O-phosphono-alpha-D-xylopyranose: R12 (= R33), S97 (= S121), H98 (= H122), K107 (= K131), D239 (= D261), R242 (= R264), R280 (≠ K302), S301 (≠ T325), G302 (= G326), E320 (= E344), S322 (= S346), H324 (= H348), R414 (= R454), S416 (= S456), N417 (≠ S457), T418 (≠ N458), R423 (≠ V463)
6np8A Xanthomonas citri phospho-pgm in complex with mannose-6-phosphate (see paper)
28% identity, 89% coverage: 27:468/498 of query aligns to 6:428/448 of 6np8A
- active site: R12 (= R33), S97 (= S121), H98 (= H122), K107 (= K131), D237 (= D259), D239 (= D261), D241 (= D263), R242 (= R264), H324 (= H348)
- binding calcium ion: S97 (= S121), D237 (= D259), D239 (= D261), D241 (= D263)
- binding 6-O-phosphono-alpha-D-mannopyranose: Y9 (= Y30), R280 (≠ K302), G302 (= G326), H303 (= H327), E320 (= E344), S322 (= S346), H324 (= H348), R414 (= R454), S416 (= S456), N417 (≠ S457), T418 (≠ N458), R423 (≠ V463)
6nolA Xanthomonas citri dephospho-pgm in complex with mannose-1-phosphate (see paper)
28% identity, 89% coverage: 27:468/498 of query aligns to 6:428/448 of 6nolA
- active site: R12 (= R33), S97 (= S121), H98 (= H122), K107 (= K131), D237 (= D259), D239 (= D261), D241 (= D263), R242 (= R264), H324 (= H348)
- binding 1-O-phosphono-alpha-D-mannopyranose: G302 (= G326), E320 (= E344), S322 (= S346), H324 (= H348), R414 (= R454), S416 (= S456), N417 (≠ S457), T418 (≠ N458), R423 (≠ V463)
- binding magnesium ion: S97 (= S121), D237 (= D259), D239 (= D261), D241 (= D263)
6nnpA Xanthomonas citri dephospho-pgm in complex with glucose-6-phosphate (see paper)
28% identity, 89% coverage: 27:468/498 of query aligns to 6:428/448 of 6nnpA
- active site: R12 (= R33), S97 (= S121), H98 (= H122), K107 (= K131), D237 (= D259), D239 (= D261), D241 (= D263), R242 (= R264), H324 (= H348)
- binding 6-O-phosphono-alpha-D-glucopyranose: R280 (≠ K302), G302 (= G326), H303 (= H327), E320 (= E344), H324 (= H348), R414 (= R454), S416 (= S456), N417 (≠ S457), T418 (≠ N458), R423 (≠ V463)
- binding magnesium ion: S97 (= S121), D237 (= D259), D239 (= D261), D241 (= D263)
Query Sequence
>CCNA_02347 FitnessBrowser__Caulo:CCNA_02347
MFSSPRADLVPNTAAYENEALVKATGFREYDARWLFGPEINLLGVQALGLGLGTYIHELG
QSKIVVGHDFRSYSTSIKNALILGLISAGCEVHDIGLALSPTAYFAQFDLDIPCVAMVTA
SHNENGWTGVKMGAQKPLTFGPDEMSRLKAIVLNAEFVERDGGKLIRVQGEAQRYIDDVA
KRASVTRPLKVIAACGNGTAGAFVVEALQKMGVAEVVPMDTDLDFTFPKYNPNPEDAEML
HAMADAVRETGADLAFGFDGDGDRCGVVDDEGEEIFADKIGLMLARDLAPLHPGATFVVD
VKSTGLYATDPILAQHGCKVIYWKTGHSYIKRKSAELGALAGFEKSGHFFMNGELGYGYD
CGLTAAAAILAMLDRNPGVKLSDMRKALPVAFTSLTMSPHCGDEVKYGVVADVVKEYEDL
FAAGGSILGRKITEVITVNGVRVHLEDGSWVLVRASSNKPEVVVVVESTQSEDDMRALFR
QEVKPRLGDRVGKYNQEI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory