SitesBLAST
Comparing CCNA_02352 FitnessBrowser__Caulo:CCNA_02352 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gy3C Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
30% identity, 93% coverage: 44:719/724 of query aligns to 18:718/732 of 8gy3C
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): M38 (≠ V64), G39 (= G65), Q40 (= Q66), H41 (≠ G67), V42 (≠ I68), A45 (= A71), G79 (= G105), G80 (= G106), S81 (= S107), S83 (≠ A109), V84 (≠ T110), G374 (= G398), F375 (= F399), L379 (= L403), L499 (= L506), R500 (= R507), V624 (= V625), D625 (≠ N626), Q632 (= Q633), T687 (= T688), G688 (= G689), L689 (= L690), G690 (= G691), E691 (= E692)
5y6qC Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
26% identity, 46% coverage: 247:578/724 of query aligns to 95:411/748 of 5y6qC
Sites not aligning to the query:
- active site: 715, 716
- binding pterin cytosine dinucleotide: 461, 462, 463, 464, 468, 500, 502, 503, 504, 505, 638, 640, 641, 648, 711, 713, 714, 715
3hrdE Crystal structure of nicotinate dehydrogenase (see paper)
25% identity, 49% coverage: 185:537/724 of query aligns to 2:380/420 of 3hrdE
- active site: Q207 (= Q368), L242 (= L403), R318 (≠ N478), H322 (≠ P483), R350 (= R507)
- binding calcium ion: T206 (= T367), N208 (= N369), D212 (≠ G373), K241 (≠ R402), L242 (= L403), D243 (≠ M404)
- binding pterin cytosine dinucleotide: G237 (= G398), F238 (= F399), R350 (= R507)
- binding selenium atom: F238 (= F399), A348 (≠ F505), F349 (≠ L506), R350 (= R507)
3hrdA Crystal structure of nicotinate dehydrogenase (see paper)
25% identity, 49% coverage: 185:537/724 of query aligns to 2:380/420 of 3hrdA
- active site: Q207 (= Q368), L242 (= L403), R318 (≠ N478), H322 (≠ P483), R350 (= R507)
- binding pterin cytosine dinucleotide: G236 (= G397), G237 (= G398), F238 (= F399), R350 (= R507)
- binding magnesium ion: T206 (= T367), N208 (= N369), D212 (≠ G373), K241 (≠ R402), L242 (= L403), D243 (≠ M404), T305 (≠ F465), Y308 (≠ G468), A309 (≠ E469), S346 (≠ T503)
- binding nicotinic acid: A314 (= A474), R318 (≠ N478), F352 (≠ P509)
- binding selenium atom: F238 (= F399), G239 (= G400), A348 (≠ F505), F349 (≠ L506), R350 (= R507)
Q0QLF2 Nicotinate dehydrogenase large molybdopterin subunit; NDH; Nicotinic acid hydroxylase large molybdopterin subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see 2 papers)
25% identity, 49% coverage: 185:537/724 of query aligns to 3:381/425 of Q0QLF2
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2:425 modified: mature protein, Nicotinate dehydrogenase large molybdopterin subunit
5g5gC Escherichia coli periplasmic aldehyde oxidase (see paper)
27% identity, 40% coverage: 245:537/724 of query aligns to 91:380/731 of 5g5gC
Sites not aligning to the query:
- active site: 692, 693
- binding pterin cytosine dinucleotide: 468, 469, 470, 507, 509, 511, 512, 617, 618, 621, 625, 688, 690, 691, 692
P77489 Aldehyde oxidoreductase molybdenum-binding subunit PaoC; EC 1.2.99.6 from Escherichia coli (strain K12) (see 2 papers)
27% identity, 40% coverage: 245:537/724 of query aligns to 91:380/732 of P77489
Sites not aligning to the query:
- 440 mutation R->H,K: Decrease in catalytic efficiency.
- 468:470 binding
- 511:512 binding
- 615:621 binding
- 625 binding
- 688:691 binding
- 692 E→Q: Loss of activity.
1t3qB Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
22% identity, 53% coverage: 190:571/724 of query aligns to 14:436/786 of 1t3qB
Sites not aligning to the query:
- active site: 743, 744
- binding pterin cytosine dinucleotide: 506, 507, 508, 510, 513, 545, 547, 549, 550, 666, 670, 674, 675, 678, 739, 740, 741, 742
3zyvB Crystal structure of the mouse liver aldehyde oxidase 3 (maox3) (see paper)
27% identity, 35% coverage: 181:432/724 of query aligns to 523:782/1262 of 3zyvB
Sites not aligning to the query:
- active site: 829, 833, 861, 1207, 1208
- binding flavin-adenine dinucleotide: 227, 229, 230, 231, 232, 233, 234, 267, 303, 304, 312, 313, 316, 317, 319, 325, 326, 366, 392, 393
- binding fe2/s2 (inorganic) cluster: 39, 41, 42, 44, 46, 49, 69, 71, 111, 112, 114, 146, 148
O33819 4-hydroxybenzoyl-CoA reductase subunit alpha; 4-HBCR subunit alpha; EC 1.1.7.1 from Thauera aromatica (see paper)
27% identity, 20% coverage: 575:719/724 of query aligns to 606:753/769 of O33819
Sites not aligning to the query:
- 214 binding
- 244:245 binding
- 522:526 binding
1rm6A Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
27% identity, 20% coverage: 575:719/724 of query aligns to 598:745/761 of 1rm6A
- active site: E718 (vs. gap), G719 (vs. gap)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): L646 (≠ I624), N647 (= N626), V651 (≠ A630), Q654 (= Q633), K714 (≠ G691), E715 (= E692), A716 (≠ P693), S717 (≠ A694), E718 (vs. gap)
Sites not aligning to the query:
- active site: 206, 241, 318, 322, 350
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 235, 236, 237, 238, 350, 473, 474, 475, 476, 513, 514, 515, 517, 518
G3X982 Aldehyde oxidase 3; Aldehyde oxidase homolog 1; Azaheterocycle hydroxylase 3; EC 1.2.3.1; EC 1.17.3.- from Mus musculus (Mouse) (see paper)
27% identity, 35% coverage: 181:432/724 of query aligns to 576:838/1335 of G3X982
- A802 (≠ G398) binding
- A807 (≠ L403) mutation to V: No effect on kinetic constants with smaller substrates like benzaldehyde or phthalazine. Decreases substrate affinity and slightly increases catalytic efficiency for bulkier substrates like phenanthridine.
Sites not aligning to the query:
- 47 binding
- 52 binding
- 55 binding
- 77 binding
- 116 binding
- 117 binding
- 120 binding
- 152 binding
- 154 binding
- 264:271 binding
- 354 binding
- 358 binding
- 367 binding
- 411 binding
- 885 Y→M: Slightly decreases substrate affinity but no effect on activity with smaller substrates like benzaldehyde or phthalazine. Increases catalytic efficiency with bulkier substrates like phenanthridine or more charged substrates like N1-methylnicotinamide.
- 889 K→H: No effect on substrate affinity but decreases catalytic efficiency for smaller substrates like benzaldehyde or phthalazine. Increases substrate affinity and activity for bulkier substrates like phenanthridine.
- 1043 binding
- 1199 binding
- 1266 E→Q: Loss of activity with different N-heterocyclic compounds as substrates. 60% reduction of activity with benzaldehyde.
8emtA Cryo-em analysis of the human aldehyde oxidase from liver (see paper)
24% identity, 38% coverage: 161:432/724 of query aligns to 479:760/1254 of 8emtA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 215, 216, 217, 218, 219, 221, 222, 223, 296, 297, 306, 309, 310, 312, 319
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 45, 46, 49, 69, 71, 111, 112, 114, 146, 148
4uhxA Human aldehyde oxidase in complex with phthalazine and thioridazine (see paper)
24% identity, 32% coverage: 204:432/724 of query aligns to 559:798/1290 of 4uhxA
Sites not aligning to the query:
- active site: 843, 847, 875, 1223, 1224
- binding flavin-adenine dinucleotide: 43, 44, 229, 230, 231, 232, 233, 234, 235, 236, 237, 310, 311, 319, 320, 323, 324, 326, 329, 332, 333, 377, 404
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 111, 112, 114, 146, 148
- binding 10-{2-[(2S)-1-methylpiperidin-2-yl]ethyl}-2-(methylsulfanyl)-10H-phenothiazine: 540, 542, 543, 1014, 1015, 1018, 1019, 1020, 1079
- binding 10-{2-[(2R)-1-methylpiperidin-2-yl]ethyl}-2-(methylsulfanyl)-10H-phenothiazine: 540, 542, 543, 1014, 1015, 1018, 1019, 1020
7dqxD Crystal structure of xanthine dehydrogenase family protein
23% identity, 65% coverage: 190:657/724 of query aligns to 6:543/770 of 7dqxD
- binding pterin cytosine dinucleotide: G247 (= G397), S248 (≠ G398), F249 (= F399), R363 (= R507), V491 (= V611), G492 (vs. gap), Q493 (vs. gap), G494 (vs. gap), V498 (= V614), S530 (= S644), W531 (≠ T645), S532 (≠ L646), S533 (≠ Y647), R534 (≠ Q648), S535 (= S649), T536 (≠ I650)
Sites not aligning to the query:
4zohA Crystal structure of glyceraldehyde oxidoreductase (see paper)
30% identity, 16% coverage: 607:719/724 of query aligns to 577:695/701 of 4zohA
Sites not aligning to the query:
- active site: 186, 219, 298, 300, 304, 332
- binding pterin cytosine dinucleotide: 213, 214, 215, 332, 442, 443, 444, 446, 482, 484, 486, 487
3hrdB Crystal structure of nicotinate dehydrogenase (see paper)
32% identity, 18% coverage: 590:719/724 of query aligns to 182:316/330 of 3hrdB
- active site: E289 (= E692), P290 (= P693)
- binding pterin cytosine dinucleotide: I215 (= I624), N216 (= N626), M219 (≠ G629), V220 (≠ A630), Q223 (= Q633), K285 (≠ T688), G286 (= G689), V287 (≠ L690), G288 (= G691), E289 (= E692)
Sites not aligning to the query:
Q0QLF1 Nicotinate dehydrogenase medium molybdopterin subunit; NDH; Nicotinic acid hydroxylase medium molybdopterin subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see paper)
32% identity, 18% coverage: 590:719/724 of query aligns to 182:316/330 of Q0QLF1
- 211:223 (vs. 620:633, 43% identical) binding
- AKGVGE 284:289 (≠ -TGLGE 688:692) binding
Sites not aligning to the query:
- 45:49 binding
- 85:90 binding
1ffvB Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava (see paper)
23% identity, 28% coverage: 202:403/724 of query aligns to 24:266/797 of 1ffvB
Sites not aligning to the query:
- active site: 343, 349, 378, 379, 751, 752
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 376, 378, 379, 516, 517, 518, 520, 523, 556, 557, 558, 560, 561, 674, 678, 683, 686, 747, 748, 749, 750, 751
1ffuB Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
23% identity, 28% coverage: 202:403/724 of query aligns to 24:266/797 of 1ffuB
Sites not aligning to the query:
- active site: 343, 349, 378, 379, 751, 752
- binding cytidine-5'-diphosphate: 518, 520, 523, 558, 560, 561, 674, 676, 678, 683, 747, 748, 749, 750
Query Sequence
>CCNA_02352 FitnessBrowser__Caulo:CCNA_02352
MDGEILRDPTRRFVLQSGAAVGGGLLLSFTMSSEGQAAGDTKVNAYVRIASDGKVTIASK
VPEVGQGIKTALPMLIAEELDVDWSAVTVEQAIADTKIYGRQVAGGSMATTLEYDGLRRV
GATVRALLIAAAAARWNVPADSLKTEPGFVVDAAGKRRASYGELAQAAAALTPPDPKSLT
LKDPKAFRIIGKSHKSQNLDAIVTGQPTYGIDVRLPGMLFAAFAKAPVYGAKVASVDLAL
AKAVKGVRDAFIIEGGTNLQGLLPGVAVVADSWWAARKGREALQIQWAEHPTASQSTVGF
AAKAAELAAAPPHRNLHNDGDVEAALKGAAKTVSAAYSYPFIAHAALEPQNCTAHVKDGK
VEIWAPTQNPESGRALVARALNVDPSAITIHLIRGGGGFGRRLMNDYMVEAAAIAAKVNA
PVQLIWTREDDMQHDFYRPGGWHNLTAGLDAKGGLTAWKNHFITFGEGETFNTAAAMNAT
QFPCRAVANYRHDVSVMPLGFPTGFLRAPGNNAFGFVIQSFTDELALAAGKDPVAFRREL
LGEPRLLGEPGKGDSFHTGRMRGVLDLVAEMSGWGRKVPKGTGLGVACHYSHLGYVAVVM
QVTVKDGAVKVDKVWAAADVGRQIVNPSGADQQMQGSILDAIGSTLYQSITFENGAATNS
NFGDFPLLRMADAPPVEVRYKLSDNNPTGLGEPAYPPAPAALCNAIFAATGKRIRSLPIG
DQLA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory