SitesBLAST
Comparing CCNA_02368 FitnessBrowser__Caulo:CCNA_02368 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3wy2A Crystal structure of alpha-glucosidase in complex with glucose (see paper)
53% identity, 91% coverage: 23:519/547 of query aligns to 1:501/535 of 3wy2A
- active site: D97 (= D119), R197 (= R219), D199 (= D221), E268 (= E284), H329 (= H346), D330 (= D347)
- binding beta-D-glucopyranose: D59 (= D81), Y62 (= Y84), H102 (= H124), R197 (= R219), D199 (= D221), E268 (= E284), H329 (= H346), D330 (= D347), R397 (= R414)
- binding glycerol: S101 (= S123), D169 (≠ Q191), V170 (≠ L192), P175 (= P197), R178 (≠ Q200), Q179 (≠ E201), F203 (= F225), Y204 (≠ S226), H206 (= H228), D240 (≠ N256), P244 (≠ A260), E280 (≠ L296)
- binding magnesium ion: D20 (= D42), R22 (≠ N44), V26 (= V48), D28 (= D50)
3wy1A Crystal structure of alpha-glucosidase (see paper)
53% identity, 91% coverage: 23:519/547 of query aligns to 1:501/535 of 3wy1A
- active site: D97 (= D119), R197 (= R219), D199 (= D221), E268 (= E284), H329 (= H346), D330 (= D347)
- binding glycerol: S101 (= S123), D169 (≠ Q191), V170 (≠ L192), F203 (= F225), Y204 (≠ S226), H206 (= H228)
- binding magnesium ion: D20 (= D42), D24 (= D46), V26 (= V48), D28 (= D50)
- binding (3R,5R,7R)-octane-1,3,5,7-tetracarboxylic acid: D59 (= D81), Y62 (= Y84), H102 (= H124), F144 (= F166), F163 (= F185), R197 (= R219), D199 (= D221), T200 (≠ A222), G225 (vs. gap), E268 (= E284), F294 (= F310), H329 (= H346), D330 (= D347), R397 (= R414)
3wy4A Crystal structure of alpha-glucosidase mutant e271q in complex with maltose (see paper)
53% identity, 91% coverage: 23:519/547 of query aligns to 1:501/535 of 3wy4A
- active site: D97 (= D119), R197 (= R219), D199 (= D221), Q268 (≠ E284), H329 (= H346), D330 (= D347)
- binding alpha-D-glucopyranose: D59 (= D81), Y62 (= Y84), H102 (= H124), I143 (≠ V165), F163 (= F185), D199 (= D221), T200 (≠ A222), G225 (vs. gap), Q268 (≠ E284), Q268 (≠ E284), F294 (= F310), H329 (= H346), D330 (= D347), R397 (= R414), R397 (= R414)
- binding glycerol: S101 (= S123), D169 (≠ Q191), V170 (≠ L192), F203 (= F225), Y204 (≠ S226), H206 (= H228), L224 (vs. gap), G225 (vs. gap), A226 (vs. gap), P227 (vs. gap), F294 (= F310), D330 (= D347), E374 (≠ Q391), K395 (≠ L412), G396 (= G413), G399 (= G416)
- binding magnesium ion: D20 (= D42), D24 (= D46), V26 (= V48), D28 (= D50)
2ze0A Alpha-glucosidase gsj (see paper)
39% identity, 89% coverage: 26:510/547 of query aligns to 4:483/531 of 2ze0A
3wy4B Crystal structure of alpha-glucosidase mutant e271q in complex with maltose (see paper)
48% identity, 67% coverage: 23:386/547 of query aligns to 1:323/421 of 3wy4B
- active site: D75 (= D119), R175 (= R219), D177 (= D221), Q237 (≠ E284)
- binding glycerol: S79 (= S123), N140 (= N184), D147 (≠ Q191), F181 (= F225), Y182 (≠ S226), F183 (≠ M227), H184 (= H228), D209 (≠ N256)
O06994 Oligo-1,6-glucosidase 1; Dextrin 6-alpha-D-glucanohydrolase; Oligosaccharide alpha-1,6-glucosidase 1; Sucrase-isomaltase 1; Isomaltase 1; EC 3.2.1.10 from Bacillus subtilis (strain 168) (see paper)
36% identity, 91% coverage: 24:519/547 of query aligns to 2:523/561 of O06994
- D20 (= D42) binding
- N22 (= N44) binding
- D24 (= D46) binding
- F26 (≠ V48) binding
- D28 (= D50) binding
4mazA The structure of mall mutant enzyme v200s from bacillus subtilus (see paper)
36% identity, 90% coverage: 25:519/547 of query aligns to 1:521/559 of 4mazA
7lv6B The structure of mall mutant enzyme s536r from bacillus subtilis
36% identity, 90% coverage: 25:519/547 of query aligns to 1:521/559 of 7lv6B
5wczA Crystal structure of wild-type mall from bacillus subtilis with ts analogue 1-deoxynojirimycin (see paper)
36% identity, 90% coverage: 25:519/547 of query aligns to 1:518/556 of 5wczA
- active site: D95 (= D119), R195 (= R219), D197 (= D221), E250 (= E284), H326 (= H346), D327 (= D347)
- binding 1-deoxynojirimycin: D57 (= D81), Y60 (= Y84), H100 (= H124), F161 (= F185), D197 (= D221), V198 (≠ A222), E250 (= E284), H326 (= H346), D327 (= D347), R413 (= R414)
4m56A The structure of wild-type mall from bacillus subtilis (see paper)
36% identity, 90% coverage: 25:519/547 of query aligns to 1:518/555 of 4m56A
- active site: D95 (= D119), R195 (= R219), D197 (= D221), E250 (= E284), H326 (= H346), D327 (= D347)
- binding D-glucose: D57 (= D81), Y60 (= Y84), H100 (= H124), F142 (= F166), D197 (= D221), E250 (= E284), D327 (= D347), R413 (= R414)
8ibkA Crystal structure of bacillus sp. Ahu2216 gh13_31 alpha-glucosidase e256q/n258g in complex with maltotriose (see paper)
34% identity, 91% coverage: 24:519/547 of query aligns to 1:510/546 of 8ibkA
- binding calcium ion: D19 (= D42), N21 (= N44), D23 (= D46), I25 (≠ V48), D27 (= D50)
- binding alpha-D-glucopyranose: D58 (= D81), Y61 (= Y84), H101 (= H124), I141 (≠ V165), F161 (= F185), D197 (= D221), A198 (= A222), H201 (= H228), M227 (≠ A260), Q254 (≠ E284), Q254 (≠ E284), F280 (= F310), H320 (= H346), D321 (= D347), R405 (= R414)
Sites not aligning to the query:
4howA The crystal structure of isomaltulose synthase from erwinia rhapontici nx5 (see paper)
34% identity, 90% coverage: 26:519/547 of query aligns to 6:520/559 of 4howA
4hphA The crystal structure of isomaltulose synthase mutant e295q from erwinia rhapontici nx5 in complex with its natural substrate sucrose (see paper)
34% identity, 90% coverage: 26:519/547 of query aligns to 6:520/559 of 4hphA
- active site: D99 (= D119), R198 (= R219), D200 (= D221), Q254 (vs. gap), H327 (= H346), D328 (= D347)
- binding calcium ion: D22 (= D42), N24 (= N44), D26 (= D46), I28 (≠ V48), D30 (= D50)
- binding beta-D-fructofuranose: F164 (= F185), Q254 (vs. gap), F256 (vs. gap), D328 (= D347), E387 (vs. gap), R415 (= R414)
- binding alpha-D-glucopyranose: D61 (= D81), Y64 (= Y84), H104 (= H124), F164 (= F185), D200 (= D221), Q254 (vs. gap), H327 (= H346), D328 (= D347), R415 (= R414)
2pwgA Crystal structure of the trehalulose synthase mutb from pseudomonas mesoacidophila mx-45 complexed to the inhibitor castanospermine (see paper)
34% identity, 91% coverage: 24:521/547 of query aligns to 3:520/556 of 2pwgA
- active site: D98 (= D119), R197 (= R219), D199 (= D221), E253 (= E284), H325 (= H346), D326 (= D347)
- binding calcium ion: D21 (= D42), N23 (= N44), D25 (= D46), I27 (≠ V48), D29 (= D50)
- binding castanospermine: D60 (= D81), Y63 (= Y84), H103 (= H124), F163 (= F185), D199 (= D221), E253 (= E284), D326 (= D347), R413 (= R414)
4h8vA Crystal structure of the trehalulose synthase mutb in complex with trehalulose
34% identity, 91% coverage: 24:521/547 of query aligns to 4:521/557 of 4h8vA
- active site: D99 (= D119), R198 (= R219), D200 (= D221), E254 (= E284), H326 (= H346), D327 (= D347)
- binding calcium ion: D22 (= D42), N24 (= N44), D26 (= D46), I28 (≠ V48), D30 (= D50)
- binding 1-O-alpha-D-glucopyranosyl-D-fructose: D61 (= D81), Y64 (= Y84), H104 (= H124), F164 (= F185), D200 (= D221), E254 (= E284), F256 (≠ G286), R284 (≠ Y314), R291 (vs. gap), H326 (= H346), D327 (= D347), E386 (vs. gap), R414 (= R414)
2pwdA Crystal structure of the trehalulose synthase mutb from pseudomonas mesoacidophila mx-45 complexed to the inhibitor deoxynojirmycin (see paper)
34% identity, 91% coverage: 24:521/547 of query aligns to 4:521/557 of 2pwdA
- active site: D99 (= D119), R198 (= R219), D200 (= D221), E254 (= E284), H326 (= H346), D327 (= D347)
- binding calcium ion: D22 (= D42), N24 (= N44), D26 (= D46), I28 (≠ V48), D30 (= D50)
- binding 1-deoxynojirimycin: D61 (= D81), Y64 (= Y84), H104 (= H124), F164 (= F185), D200 (= D221), E254 (= E284), H326 (= H346), D327 (= D347), R414 (= R414)
2pweA Crystal structure of the mutb e254q mutant in complex with the substrate sucrose (see paper)
34% identity, 91% coverage: 24:521/547 of query aligns to 3:520/556 of 2pweA
- active site: D98 (= D119), R197 (= R219), D199 (= D221), Q253 (≠ G287), H325 (= H346), D326 (= D347)
- binding calcium ion: D21 (= D42), N23 (= N44), D25 (= D46), I27 (≠ V48), D29 (= D50)
- binding beta-D-fructofuranose: F163 (= F185), Q253 (≠ G287), F255 (≠ H289), D326 (= D347), R413 (= R414)
- binding alpha-D-glucopyranose: D60 (= D81), Y63 (= Y84), H103 (= H124), F163 (= F185), D199 (= D221), Q253 (≠ G287), H325 (= H346), D326 (= D347), R413 (= R414)
7p01A Structure of the maltase baag2 from blastobotrys adeninivorans in complex with acarbose (see paper)
33% identity, 91% coverage: 23:518/547 of query aligns to 4:537/572 of 7p01A
- binding 4,6-dideoxy-4-{[(1S,4R,5S,6S)-4,5,6-trihydroxy-3-(hydroxymethyl)cyclohex-2-en-1-yl]amino}-alpha-D-glucopyranose: D62 (= D81), Y65 (= Y84), H105 (= H124), Y150 (≠ V165), F170 (= F185), D207 (= D221), T208 (≠ A222), E265 (≠ G287), F291 (= F310), H338 (= H346), D339 (= D347), R431 (= R414), T529 (≠ G510), D530 (≠ F511)
- binding calcium ion: D23 (= D42), N25 (= N44), D27 (= D46), I29 (≠ V48), D31 (= D50)
- binding alpha-D-glucopyranose: R224 (≠ L238), F291 (= F310), A295 (vs. gap), E300 (vs. gap), S349 (vs. gap), D350 (vs. gap), D350 (vs. gap), A351 (vs. gap), Q427 (= Q410), K428 (≠ T411)
- binding 1-methylpyrrolidin-2-one: S19 (≠ R38), I29 (≠ V48), M63 (≠ F82), H74 (≠ D93), W454 (= W438)
4hozA The crystal structure of isomaltulose synthase mutant d241a from erwinia rhapontici nx5 in complex with d-glucose (see paper)
33% identity, 90% coverage: 26:519/547 of query aligns to 6:520/559 of 4hozA
- active site: D99 (= D119), R198 (= R219), A200 (≠ D221), E254 (= E284), H327 (= H346), D328 (= D347)
- binding calcium ion: D22 (= D42), N24 (= N44), D26 (= D46), I28 (≠ V48), D30 (= D50)
- binding alpha-D-glucopyranose: D61 (= D81), Y64 (= Y84), H104 (= H124), F164 (= F185), R198 (= R219), A200 (≠ D221), E254 (= E284), H327 (= H346), D328 (= D347), R415 (= R414)
5brpA Crystal structure of bacillus licheniformis trehalose-6-phosphate hydrolase (trea), mutant r201q, in complex with png (see paper)
34% identity, 90% coverage: 26:520/547 of query aligns to 3:515/555 of 5brpA
- active site: D96 (= D119), Q196 (≠ R219), D198 (= D221), E249 (= E284), H323 (= H346), D324 (= D347)
- binding magnesium ion: D19 (= D42), T21 (≠ N44), N23 (≠ D46), V25 (= V48), D27 (= D50)
- binding 4-nitrophenyl alpha-D-glucopyranoside: D58 (= D81), N59 (≠ F82), Y61 (= Y84), H101 (= H124), Y162 (≠ F185), D198 (= D221), V199 (≠ A222), E249 (= E284)
Query Sequence
>CCNA_02368 FitnessBrowser__Caulo:CCNA_02368
MRFRGTIVTVQLLERPDAETSMNAEWWRGAVIYQVYPRSFADSNGDGVGDLPGITAHLDH
IASLGVEGVWLSPFFTSPMKDFGYDVSNYCDVDPIFGTLADFDALIARAHALGLKIIIDL
VFSHTSDEHPWFVESRQDRSNAKADWFVWADAKPDGSPPSNWQSVFGGPAWTWDARRGQY
YMHNFLSSQPQLNLHNPAVQEALLAVTQFWIDKGVDGFRFDAINFSMHDPALTDNPPLPP
GGKRTRPFDFQDKIHNQSHADIPKFLSRLRALTDAAGGRFSVAEVGGDHAEREMKLFTAG
EDRLNSAYGFLYLYADKLIGEMIPQGAAMWPGEAGEGWPSWTFSNHDAPRAVSRWAEGRD
RKAFAELCLLLLMGLRGNVFVYQGEELGLPQAHVPFERLQDPEAIANWPQTLGRDGARTP
MPWVSGALNAGFSGVEPWLPVDPEHLPLAVDAQEADPASTLNVARRLIGLRRAYPALRTG
AITFIDTNSPLLIFQRGEGADAVLLAFNLGFETVTWSLPDGWTLIDGVNLGGEGQMPVCA
GLIARRG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory