SitesBLAST
Comparing CCNA_02387 FitnessBrowser__Caulo:CCNA_02387 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4dnaA Crystal structure of putative glutathione reductase from sinorhizobium meliloti 1021
50% identity, 98% coverage: 4:460/466 of query aligns to 2:451/461 of 4dnaA
- active site: Y37 (≠ V39), C41 (= C43), C46 (= C48), K49 (= K51), Y178 (= Y184), E182 (= E188), A435 (= A441), H437 (= H443), E442 (= E448)
- binding flavin-adenine dinucleotide: I9 (= I11), G10 (= G12), G11 (≠ A13), G12 (= G14), G14 (= G16), E33 (= E35), E34 (= E36), G39 (= G41), T40 (= T42), C41 (= C43), G45 (= G47), C46 (= C48), K49 (= K51), R112 (= R114), A113 (= A115), V139 (≠ T146), G140 (= G147), Y178 (= Y184), R264 (= R270), G303 (= G309), D304 (= D310), Q310 (≠ N316), L311 (= L317), T312 (= T318)
Sites not aligning to the query:
3o0hB Crystal structure of glutathione reductase from bartonella henselae
48% identity, 98% coverage: 4:462/466 of query aligns to 2:451/459 of 3o0hB
- active site: S13 (= S15), I37 (≠ V39), C41 (= C43), C46 (= C48), K49 (= K51), D74 (= D76), P75 (≠ A77), Y177 (= Y184), E181 (= E188), I314 (= I322), A433 (= A441), H435 (= H443), E440 (= E448)
- binding flavin-adenine dinucleotide: I9 (= I11), G10 (= G12), G12 (= G14), S13 (= S15), G14 (= G16), A32 (= A34), E33 (= E35), E34 (= E36), T40 (= T42), C41 (= C43), G45 (= G47), C46 (= C48), K49 (= K51), R112 (= R114), A113 (= A115), T139 (= T146), G140 (= G147), Y177 (= Y184), R262 (= R270), N265 (≠ Y273), G301 (= G309), D302 (= D310), Q308 (≠ N316), L309 (= L317), T310 (= T318)
Sites not aligning to the query:
6i7nB Trypanothione reductase from leismania infantum in complex with trl156 (see paper)
42% identity, 96% coverage: 6:454/466 of query aligns to 5:472/488 of 6i7nB
- active site: C52 (= C43), C57 (= C48), K60 (= K51), Y198 (= Y184), E202 (= E188), H461 (= H443), E466 (= E448)
- binding flavin-adenine dinucleotide: G11 (= G12), G15 (= G16), D35 (≠ E35), A46 (vs. gap), A47 (vs. gap), G50 (= G41), T51 (= T42), C52 (= C43), G56 (= G47), C57 (= C48), K60 (= K51), G127 (≠ A115), A159 (= A145), T160 (= T146), G161 (= G147), Y198 (= Y184), R287 (= R270), G326 (= G309), D327 (= D310), M333 (≠ N316), L334 (= L317), T335 (= T318)
- binding ~{N}-(4-azanylbutyl)-~{N}-(2-azanyl-2-oxidanylidene-ethyl)-7-(3-azanyl-3-oxidanylidene-propyl)-4-(dimethylamino)-2-(2-naphthalen-2-ylethylamino)pyrrolo[2,3-d]pyrimidine-6-carboxamide: L17 (≠ V18), E18 (≠ R19), Y110 (= Y99)
Sites not aligning to the query:
6er5A X-ray structure of trypanothione reductase from leishmania infantum in complex with 2-(diethylamino)ethyl 4-((3-(4-nitrophenyl)-3- oxopropyl)amino)benzoate (see paper)
42% identity, 96% coverage: 6:454/466 of query aligns to 5:472/488 of 6er5A
- active site: C52 (= C43), C57 (= C48), K60 (= K51), Y198 (= Y184), E202 (= E188), H461 (= H443), E466 (= E448)
- binding 2-(diethylamino)ethyl 4-((3-(4-nitrophenyl)-3-oxopropyl)amino)benzoate: Y221 (= Y204), R222 (= R205), R228 (= R211), I285 (≠ T268)
- binding flavin-adenine dinucleotide: G11 (= G12), G13 (= G14), G15 (= G16), V34 (≠ A34), D35 (≠ E35), V36 (≠ E36), A46 (vs. gap), A47 (vs. gap), G50 (= G41), T51 (= T42), C52 (= C43), G56 (= G47), C57 (= C48), K60 (= K51), G127 (≠ A115), T160 (= T146), Y198 (= Y184), R287 (= R270), R290 (≠ Y273), G326 (= G309), D327 (= D310), M333 (≠ N316), L334 (= L317), T335 (= T318)
Sites not aligning to the query:
4apnA Structure of tr from leishmania infantum in complex with a diarylpirrole-based inhibitor (see paper)
42% identity, 96% coverage: 6:454/466 of query aligns to 5:472/488 of 4apnA
- active site: L48 (≠ V39), C52 (= C43), C57 (= C48), K60 (= K51), Y198 (= Y184), E202 (= E188), G459 (≠ A441), H461 (= H443), E466 (= E448)
- binding flavin-adenine dinucleotide: G11 (= G12), G13 (= G14), S14 (= S15), D35 (≠ E35), A46 (vs. gap), G50 (= G41), T51 (= T42), G56 (= G47), C57 (= C48), K60 (= K51), G127 (≠ A115), T160 (= T146), R287 (= R270), R290 (≠ Y273), G326 (= G309), D327 (= D310), L334 (= L317), T335 (= T318)
- binding 4-[[1-(4-ethylphenyl)-2-methyl-5-(4-methylsulfanylphenyl)pyrrol-3-yl]methyl]thiomorpholine: L17 (≠ V18), E18 (≠ R19), S109 (≠ I98), Y110 (= Y99), M113 (≠ N102), F396 (= F379), T397 (≠ R380)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G196 (= G182), G197 (= G183), Y198 (= Y184), I199 (= I185), E202 (= E188), Y221 (= Y204), R222 (= R205), R228 (= R211), A284 (= A267), I285 (≠ T268), G286 (= G269), R287 (= R270), M333 (≠ N316), A365 (= A348)
Sites not aligning to the query:
4adwA Crystal structure of leishmania infantum trypanothione reductase in complex with NADPH and trypanothione (see paper)
42% identity, 96% coverage: 6:454/466 of query aligns to 5:472/488 of 4adwA
- active site: L48 (≠ V39), C52 (= C43), C57 (= C48), K60 (= K51), Y198 (= Y184), E202 (= E188), G459 (≠ A441), H461 (= H443), E466 (= E448)
- binding flavin-adenine dinucleotide: G11 (= G12), G13 (= G14), S14 (= S15), G15 (= G16), D35 (≠ E35), A46 (vs. gap), G50 (= G41), T51 (= T42), C52 (= C43), G56 (= G47), C57 (= C48), K60 (= K51), G127 (≠ A115), A159 (= A145), T160 (= T146), R287 (= R270), R290 (≠ Y273), G326 (= G309), D327 (= D310), M333 (≠ N316), L334 (= L317), T335 (= T318), H461 (= H443), P462 (= P444)
- binding bis(gamma-glutamyl-cysteinyl-glycinyl)spermidine: F396 (= F379), L399 (≠ M382), H461 (= H443), E466 (= E448)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G196 (= G182), G197 (= G183), Y198 (= Y184), I199 (= I185), Y221 (= Y204), R222 (= R205), R228 (= R211), I285 (≠ T268), G286 (= G269), R287 (= R270), A365 (= A348)
Sites not aligning to the query:
2yauA X-ray structure of the leishmania infantum tryopanothione reductase in complex with auranofin (see paper)
42% identity, 96% coverage: 6:454/466 of query aligns to 5:472/488 of 2yauA
- active site: L48 (≠ V39), C52 (= C43), C57 (= C48), K60 (= K51), Y198 (= Y184), E202 (= E188), G459 (≠ A441), H461 (= H443), E466 (= E448)
- binding gold ion: C52 (= C43), C57 (= C48), T335 (= T318)
- binding flavin-adenine dinucleotide: G11 (= G12), G13 (= G14), G15 (= G16), D35 (≠ E35), V36 (≠ E36), A46 (vs. gap), A47 (vs. gap), G50 (= G41), T51 (= T42), C52 (= C43), G56 (= G47), C57 (= C48), K60 (= K51), F126 (≠ R114), G127 (≠ A115), A159 (= A145), T160 (= T146), R287 (= R270), R290 (≠ Y273), D327 (= D310), L334 (= L317), T335 (= T318)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G196 (= G182), G197 (= G183), Y198 (= Y184), I199 (= I185), E202 (= E188), Y221 (= Y204), R222 (= R205), R228 (= R211), I285 (≠ T268), G286 (= G269), R287 (= R270), M333 (≠ N316), A365 (= A348)
- binding 2,3,4,6-tetra-O-acetyl-1-thio-beta-D-glucopyranose: F396 (= F379), L399 (≠ M382), H461 (= H443)
Sites not aligning to the query:
2x50A Crystal structure of trypanothione reductase from leishmania infantum in complex with NADPH and silver (see paper)
42% identity, 96% coverage: 6:454/466 of query aligns to 4:471/485 of 2x50A
- active site: L47 (≠ V39), C51 (= C43), C56 (= C48), K59 (= K51), Y197 (= Y184), E201 (= E188), G458 (≠ A441), H460 (= H443), E465 (= E448)
- binding silver ion: C51 (= C43), C56 (= C48), T334 (= T318)
- binding flavin-adenine dinucleotide: G12 (= G14), S13 (= S15), V33 (≠ A34), D34 (≠ E35), A45 (vs. gap), G49 (= G41), T50 (= T42), C51 (= C43), G55 (= G47), C56 (= C48), K59 (= K51), G126 (≠ A115), T159 (= T146), R286 (= R270), R289 (≠ Y273), G325 (= G309), D326 (= D310), L333 (= L317), T334 (= T318)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G195 (= G182), G196 (= G183), Y197 (= Y184), I198 (= I185), E201 (= E188), Y220 (= Y204), R221 (= R205), R227 (= R211), A283 (= A267), I284 (≠ T268), G285 (= G269), R286 (= R270), M332 (≠ N316), A364 (= A348)
Sites not aligning to the query:
2w0hA X ray structure of leishmania infantum trypanothione reductase in complex with antimony and NADPH (see paper)
42% identity, 96% coverage: 6:454/466 of query aligns to 4:471/485 of 2w0hA
- active site: L47 (≠ V39), C51 (= C43), C56 (= C48), K59 (= K51), Y197 (= Y184), E201 (= E188), G458 (≠ A441), H460 (= H443), E465 (= E448)
- binding flavin-adenine dinucleotide: G10 (= G12), G12 (= G14), S13 (= S15), G14 (= G16), V33 (≠ A34), D34 (≠ E35), A45 (vs. gap), G49 (= G41), T50 (= T42), C51 (= C43), G55 (= G47), C56 (= C48), K59 (= K51), G126 (≠ A115), T159 (= T146), R286 (= R270), R289 (≠ Y273), G325 (= G309), D326 (= D310), L333 (= L317), T334 (= T318)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G195 (= G182), G196 (= G183), Y197 (= Y184), I198 (= I185), E201 (= E188), Y220 (= Y204), R221 (= R205), R227 (= R211), N253 (≠ S237), A283 (= A267), I284 (≠ T268), G285 (= G269), R286 (= R270), M332 (≠ N316), A364 (= A348)
- binding antimony (iii) ion: C51 (= C43), C56 (= C48), T334 (= T318)
Sites not aligning to the query:
6t98A Trypanothione reductase from leishmania infantum in complex with 9a (see paper)
42% identity, 96% coverage: 6:454/466 of query aligns to 6:473/489 of 6t98A
- active site: C53 (= C43), C58 (= C48), K61 (= K51), Y199 (= Y184), E203 (= E188), H462 (= H443), E467 (= E448)
- binding flavin-adenine dinucleotide: G12 (= G12), G14 (= G14), S15 (= S15), G16 (= G16), V35 (≠ A34), D36 (≠ E35), A47 (vs. gap), G51 (= G41), T52 (= T42), C53 (= C43), G57 (= G47), C58 (= C48), K61 (= K51), G128 (≠ A115), T161 (= T146), Y199 (= Y184), I200 (= I185), R288 (= R270), R291 (≠ Y273), G327 (= G309), D328 (= D310), M334 (≠ N316), L335 (= L317), T336 (= T318)
- binding 4-[3-methyl-1-[4-[4-(2-phenylethyl)-1,3-thiazol-2-yl]-3-(2-piperidin-4-ylethoxy)phenyl]-1,2,3-triazol-3-ium-4-yl]butan-1-amine: W22 (≠ R22), S106 (≠ R94), S110 (≠ I98), M114 (≠ N102), D117 (≠ K105)
Sites not aligning to the query:
6t97A Trypanothione reductase from leismania infantum in complex with trl190
42% identity, 96% coverage: 6:454/466 of query aligns to 6:473/489 of 6t97A
- active site: C53 (= C43), C58 (= C48), K61 (= K51), Y199 (= Y184), E203 (= E188), H462 (= H443), E467 (= E448)
- binding flavin-adenine dinucleotide: G12 (= G12), G14 (= G14), S15 (= S15), G16 (= G16), V35 (≠ A34), D36 (≠ E35), A47 (vs. gap), A48 (vs. gap), T52 (= T42), C53 (= C43), G57 (= G47), C58 (= C48), K61 (= K51), G128 (≠ A115), T161 (= T146), G162 (= G147), Y199 (= Y184), I200 (= I185), R288 (= R270), R291 (≠ Y273), G327 (= G309), D328 (= D310), M334 (≠ N316), L335 (= L317), T336 (= T318)
- binding 4-[1-[4-[4-(2-phenylethyl)-1,3-thiazol-2-yl]-3-(2-piperidin-4-ylethoxy)phenyl]-1,2,3-triazol-4-yl]butan-1-amine: E19 (≠ R19), W22 (≠ R22), S106 (≠ R94), S110 (≠ I98), Y111 (= Y99), M114 (≠ N102), D117 (≠ K105)
Sites not aligning to the query:
6t95A Trypanothione reductase from leismania infantum in complex with 4a (see paper)
42% identity, 96% coverage: 6:454/466 of query aligns to 6:473/489 of 6t95A
- active site: C53 (= C43), C58 (= C48), K61 (= K51), Y199 (= Y184), E203 (= E188), H462 (= H443), E467 (= E448)
- binding flavin-adenine dinucleotide: G12 (= G12), G14 (= G14), S15 (= S15), G16 (= G16), D36 (≠ E35), V37 (≠ E36), A47 (vs. gap), A48 (vs. gap), G51 (= G41), T52 (= T42), C53 (= C43), G57 (= G47), C58 (= C48), K61 (= K51), G128 (≠ A115), T161 (= T146), G162 (= G147), Y199 (= Y184), R288 (= R270), R291 (≠ Y273), G327 (= G309), D328 (= D310), M334 (≠ N316), L335 (= L317), T336 (= T318)
- binding 1-[2-[5-[4-(4-azanylbutyl)-3-methyl-1,2,3-triazol-3-ium-1-yl]-2-[4-(2-phenylethyl)-1,3-thiazol-2-yl]phenoxy]ethyl]imidazolidin-2-one: E19 (≠ R19), W22 (≠ R22), S106 (≠ R94), I107 (≠ L95), S110 (≠ I98), Y111 (= Y99), M114 (≠ N102), D117 (≠ K105)
Sites not aligning to the query:
6i7nA Trypanothione reductase from leismania infantum in complex with trl156 (see paper)
42% identity, 96% coverage: 6:454/466 of query aligns to 6:473/490 of 6i7nA
- active site: C53 (= C43), C58 (= C48), K61 (= K51), Y199 (= Y184), E203 (= E188), H462 (= H443), E467 (= E448)
- binding flavin-adenine dinucleotide: G12 (= G12), G14 (= G14), S15 (= S15), G16 (= G16), D36 (≠ E35), A47 (vs. gap), A48 (vs. gap), G51 (= G41), T52 (= T42), C53 (= C43), G57 (= G47), C58 (= C48), K61 (= K51), G128 (≠ A115), A160 (= A145), T161 (= T146), G162 (= G147), R288 (= R270), D328 (= D310), L335 (= L317), T336 (= T318), A339 (= A321)
Sites not aligning to the query:
5ebkA Trypanothione reductase in complex with 6-(sec-butoxy)-2-((3- chlorophenyl)thio)pyrimidin-4-amine (see paper)
42% identity, 96% coverage: 6:454/466 of query aligns to 5:472/486 of 5ebkA
- active site: L48 (≠ V39), C52 (= C43), C57 (= C48), K60 (= K51), Y198 (= Y184), E202 (= E188), G459 (≠ A441), H461 (= H443), E466 (= E448)
- binding flavin-adenine dinucleotide: G11 (= G12), G13 (= G14), S14 (= S15), D35 (≠ E35), V36 (≠ E36), A46 (vs. gap), A47 (vs. gap), G50 (= G41), T51 (= T42), C52 (= C43), G56 (= G47), K60 (= K51), G127 (≠ A115), A159 (= A145), T160 (= T146), G161 (= G147), S178 (= S164), Y198 (= Y184), R287 (= R270), R290 (≠ Y273), G326 (= G309), D327 (= D310), M333 (≠ N316), L334 (= L317), T335 (= T318), A338 (= A321)
- binding 6-sec-Butoxy-2-[(3-chlorophenyl)sulfanyl]-4-pyrimidinamine: C52 (= C43), V53 (= V44), Y110 (= Y99), Y221 (= Y204), R222 (= R205), R222 (= R205), D224 (≠ A207), R228 (= R211), N252 (≠ G235), N254 (≠ S237), I285 (≠ T268), H461 (= H443), E466 (= E448)
Sites not aligning to the query:
1feaA Unliganded crithidia fasciculata trypanothione reductase at 2.2 angstrom resolution
42% identity, 96% coverage: 6:454/466 of query aligns to 4:471/487 of 1feaA
- active site: S13 (= S15), L47 (≠ V39), C51 (= C43), C56 (= C48), K59 (= K51), R84 (vs. gap), E85 (= E75), Y197 (= Y184), E201 (= E188), I338 (= I322), G458 (≠ A441), H460 (= H443), E465 (= E448)
- binding flavin-adenine dinucleotide: I9 (= I11), G10 (= G12), G12 (= G14), S13 (= S15), G14 (= G16), I33 (≠ A34), D34 (≠ E35), L35 (≠ E36), G49 (= G41), T50 (= T42), C51 (= C43), V54 (≠ R46), G55 (= G47), C56 (= C48), K59 (= K51), F125 (≠ R114), T159 (= T146), G160 (= G147), Y197 (= Y184), I198 (= I185), R286 (= R270), R289 (≠ Y273), G325 (= G309), D326 (= D310), M332 (≠ N316), L333 (= L317), T334 (= T318), A337 (= A321)
Sites not aligning to the query:
P39040 Trypanothione reductase; TR; N(1),N(8)-bis(glutathionyl)spermidine reductase; EC 1.8.1.12 from Crithidia fasciculata (see paper)
41% identity, 96% coverage: 6:454/466 of query aligns to 5:472/491 of P39040
- C52 (= C43) modified: Disulfide link with 57, Redox-active
- C57 (= C48) modified: Disulfide link with 52, Redox-active
1typA Substrate interactions between trypanothione reductase and n1-glutathionylspermidine disulphide at 0.28-nm resolution (see paper)
41% identity, 96% coverage: 6:454/466 of query aligns to 5:472/487 of 1typA
- active site: S14 (= S15), L48 (≠ V39), C52 (= C43), C57 (= C48), K60 (= K51), R85 (vs. gap), E86 (= E75), Y198 (= Y184), E202 (= E188), I339 (= I322), G459 (≠ A441), H461 (= H443), E466 (= E448)
- binding flavin-adenine dinucleotide: I10 (= I11), G11 (= G12), G13 (= G14), S14 (= S15), D35 (≠ E35), A46 (vs. gap), G50 (= G41), T51 (= T42), C52 (= C43), G56 (= G47), C57 (= C48), K60 (= K51), G127 (≠ A115), T160 (= T146), G161 (= G147), Y198 (= Y184), I199 (= I185), R287 (= R270), R290 (≠ Y273), G326 (= G309), D327 (= D310), L334 (= L317), T335 (= T318)
- binding glutathione: S14 (= S15), Y110 (= Y99), I339 (= I322), F396 (= F379), H461 (= H443), P462 (= P444), T463 (= T445), S470 (≠ T452)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G196 (= G182), G197 (= G183), Y198 (= Y184), Y221 (= Y204), R222 (= R205), R228 (= R211), I285 (≠ T268), M333 (≠ N316), C364 (≠ S347)
- binding spermidine: L17 (≠ V18), E18 (≠ R19), W21 (vs. gap), M113 (≠ N102)
Sites not aligning to the query:
6n7fA 1.90 angstrom resolution crystal structure of glutathione reductase from streptococcus pyogenes in complex with fad.
41% identity, 96% coverage: 6:454/466 of query aligns to 6:451/451 of 6n7fA
- active site: C43 (= C43), C48 (= C48), K51 (= K51), Y178 (= Y184), E182 (= E188), H440 (= H443), E445 (= E448)
- binding flavin-adenine dinucleotide: I11 (= I11), G12 (= G12), G14 (= G14), S15 (= S15), A16 (≠ G16), A34 (= A34), E35 (= E35), G36 (≠ E36), K37 (≠ Y37), G41 (= G41), T42 (= T42), C43 (= C43), G47 (= G47), C48 (= C48), K51 (= K51), Y115 (≠ R114), A116 (= A115), T140 (= T146), G141 (= G147), Y178 (= Y184), I179 (= I185), R264 (= R270), G303 (= G309), D304 (= D310), L311 (= L317), T312 (= T318)
- binding riboflavin: G36 (≠ E36), K37 (≠ Y37), Y115 (≠ R114), G270 (= G276)
5grtA Human glutathione reductase a34e, r37w mutant, glutathionylspermidine complex (see paper)
38% identity, 96% coverage: 6:454/466 of query aligns to 4:461/461 of 5grtA
- active site: L37 (≠ V39), C41 (= C43), C46 (= C48), K49 (= K51), Y180 (= Y184), E184 (= E188), A448 (= A441), H450 (= H443), E455 (= E448)
- binding flavin-adenine dinucleotide: I9 (= I11), G12 (= G14), G14 (= G16), V32 (≠ A34), E33 (= E35), S34 (≠ E36), G39 (= G41), T40 (= T42), C41 (= C43), G45 (= G47), C46 (= C48), K49 (= K51), H112 (≠ R114), A113 (= A115), T139 (= T146), Y180 (= Y184), G313 (= G309), D314 (= D310), L320 (≠ N316), L321 (= L317), T322 (= T318)
- binding glutathionylspermidine disulfide: S13 (= S15), E17 (≠ R19), C41 (= C43), V42 (= V44), Y89 (≠ E91), L93 (= L95), I96 (= I98), Y97 (= Y99), T322 (= T318), I326 (= I322)
1gerB The structure of glutathione reductase from escherichia coli at 1.86 angstroms resolution: comparison with the enzyme from human erythrocytes (see paper)
40% identity, 92% coverage: 24:454/466 of query aligns to 22:449/449 of 1gerB
- active site: L37 (≠ V39), C41 (= C43), C46 (= C48), K49 (= K51), Y176 (= Y184), E180 (= E188), A436 (= A441), H438 (= H443), E443 (= E448)
- binding flavin-adenine dinucleotide: E33 (= E35), A34 (≠ E36), G39 (= G41), T40 (= T42), C41 (= C43), G45 (= G47), C46 (= C48), K49 (= K51), F113 (≠ R114), A114 (= A115), T138 (= T146), Y176 (= Y184), I177 (= I185), R262 (= R270), G301 (= G309), D302 (= D310), E308 (≠ N316), L309 (= L317), T310 (= T318)
Sites not aligning to the query:
Query Sequence
>CCNA_02387 FitnessBrowser__Caulo:CCNA_02387
MADYDFDLFVIGAGSGGVRAARLAALSGAKVAVAEEYRVGGTCVVRGCVPKKFMVYASEV
TSQLKTAKGYGWTIEDARFDWKTFLHEKDVEIARLSGIYVTNLQKAGAHLLHGRAQIVDA
HTVEVLPKDGSDDAGTYTARKILVATGGRPVRPVFPGAELGITSDEAFHLPTLPKSVLVV
GGGYIAVEFAGIYAGLGVQTTLLYRGANILRGFDDDVRMHLADELEKRGIKVVLGCSHKS
IEKLDDGRLLSTLSNDLTFETEAVMFATGREPYVQGLGLEKAGVKLNDKGAIAVDKYSKT
NVDSIWAVGDVTDRINLTPVAIREGAAFAQTEFYGNPTTFDHDLVASAVFSQPPVGAVGM
SEAEARQAFGKVDIYRSIFRPMKVTFYGGQERCLIKLVVKQDDERILGVHVVGPDSPEII
QMAAIAVKMGVTKPQWDSTCAVHPTLAEELVTMREKYVPAEVGGAG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory