Comparing CCNA_02404 FitnessBrowser__Caulo:CCNA_02404 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
40% identity, 86% coverage: 21:259/278 of query aligns to 3:240/253 of 6z5uK
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
40% identity, 86% coverage: 21:259/278 of query aligns to 5:242/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
40% identity, 86% coverage: 21:259/278 of query aligns to 5:242/263 of 7d08B
7chaI Cryo-em structure of p.Aeruginosa mlafebd with amppnp (see paper)
39% identity, 87% coverage: 19:259/278 of query aligns to 2:241/262 of 7chaI
7ch8I Cryo-em structure of p.Aeruginosa mlafebd with adp-v (see paper)
37% identity, 87% coverage: 19:259/278 of query aligns to 2:238/259 of 7ch8I
6xgyA Crystal structure of e. Coli mlafb abc transport subunits in the dimeric state (see paper)
38% identity, 86% coverage: 21:259/278 of query aligns to 5:242/264 of 6xgyA
7ch6C Cryo-em structure of e.Coli mlafeb with amppnp (see paper)
38% identity, 86% coverage: 21:259/278 of query aligns to 5:242/265 of 7ch6C
7cgnB The overall structure of the mlafedb complex in atp-bound eqtall conformation (mutation of e170q on mlaf) (see paper)
38% identity, 86% coverage: 21:259/278 of query aligns to 5:242/263 of 7cgnB
Q9AT00 Protein TRIGALACTOSYLDIACYLGLYCEROL 3, chloroplastic; ABC transporter I family member 13; ABC transporter ABCI.13; AtABCI13; Non-intrinsic ABC protein 11; AtNAP11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
36% identity, 86% coverage: 21:259/278 of query aligns to 85:337/345 of Q9AT00
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
35% identity, 80% coverage: 37:258/278 of query aligns to 22:241/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
34% identity, 80% coverage: 37:258/278 of query aligns to 23:242/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
34% identity, 80% coverage: 37:258/278 of query aligns to 23:242/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
34% identity, 80% coverage: 37:258/278 of query aligns to 23:242/344 of 3tuiC
Sites not aligning to the query:
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
37% identity, 77% coverage: 27:239/278 of query aligns to 12:222/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
37% identity, 77% coverage: 27:239/278 of query aligns to 12:222/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
37% identity, 77% coverage: 27:239/278 of query aligns to 12:222/353 of 1oxuA
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
37% identity, 77% coverage: 27:239/278 of query aligns to 12:222/353 of Q97UY8
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
34% identity, 78% coverage: 21:237/278 of query aligns to 2:215/240 of 4ymuJ
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
35% identity, 78% coverage: 21:237/278 of query aligns to 3:215/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
33% identity, 76% coverage: 21:231/278 of query aligns to 4:211/242 of 3c4jA
>CCNA_02404 FitnessBrowser__Caulo:CCNA_02404
MTAPAFDAPGAETPDAERYPIEVRGLVSRFGDNVVHDGLDLKVEQGEILGVVGGSGSGKS
VLLNSIIGLKTPDDGHVRLFGGDMRVASRRRWSSVERRWGVLFQQGALFSNLTVRENVAA
PLYEHTRLPRSEVEAIADLKIAMVGLPARAATLKPAELSGGMRKRAGLARALAMDPELLF
LDEPTAGLDPIGAQAFDALIKDLSDSLELTVFMITHDLDSLYTITDRVAVLADKKVVTVA
PVGELERSDHPWIKQYFLGPRGRAAAAAKEHAKSRTDD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory