Comparing CCNA_02439 FitnessBrowser__Caulo:CCNA_02439 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
P53322 High-affinity nicotinic acid transporter; Nicotinic acid permease from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
21% identity, 75% coverage: 4:325/430 of query aligns to 76:399/534 of P53322
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
27% identity, 95% coverage: 18:425/430 of query aligns to 2:409/409 of 6e9nA
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
26% identity, 99% coverage: 1:426/430 of query aligns to 1:429/430 of P0AA76
6e9oA E. Coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form (see paper)
26% identity, 96% coverage: 14:425/430 of query aligns to 3:393/393 of 6e9oA
Q9C0U9 Uncharacterized transporter PB1C11.03 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
21% identity, 64% coverage: 29:305/430 of query aligns to 111:396/570 of Q9C0U9
Sites not aligning to the query:
Q9GQQ0 Protein spinster; Protein benchwarmer; Protein diphthong from Drosophila melanogaster (Fruit fly) (see paper)
25% identity, 41% coverage: 11:185/430 of query aligns to 107:276/605 of Q9GQQ0
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
25% identity, 43% coverage: 94:276/430 of query aligns to 97:287/452 of Q5EXK5
Sites not aligning to the query:
>CCNA_02439 FitnessBrowser__Caulo:CCNA_02439
MSDPSSALERATVGRVTRRLMPLFCLMYLIAYIDRQNVSYAKLDMVSALGLSEAAYGLGA
SLFFIGYFLFEAPANLILARVGARVWFARIMFSWGLVTLALGFTQNAAMFYVLRFLLGVA
EAGFFPGVLYVLTLWYPQAHRARMVGLFMIASAFANAVGAAIGGLLLGMDGFLGLAGWQW
VFLVTGAPAVLLAPYVLWRLPSGPSDARWLPDVEKSWLASTLAAERGGEVDDHRGAWKAI
FDPRVLMLAGLYIGMPLSAYGLSYWLPTIVKSFGVSNTVNGFINVIPWLLVAVALWFVPR
HAARHGASAWHIAGPVLLAAVALSLSVILPGAALKFTMLCIAAPAIFAAQPVFWSLPPSF
LSGPRAAAGIATINAVGNLGGFIAQNLVPVVRDATGSELAPMLALAAVLLVTSLLIFIVM
GRLRKMSPAT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory