Comparing CCNA_02478 FitnessBrowser__Caulo:CCNA_02478 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7zm4A Crystal structure of hsad from mycobacterium tuberculosis in complex with cyclipostin-like inhibitor cyc31 (see paper)
30% identity, 86% coverage: 26:283/300 of query aligns to 16:274/284 of 7zm4A
7zm3A Crystal structure of hsad from mycobacterium tuberculosis in complex with cyclipostin-like inhibitor cyc17 (see paper)
30% identity, 86% coverage: 26:283/300 of query aligns to 16:274/284 of 7zm3A
7zm2A Crystal structure of hsad from mycobacterium tuberculosis in complex with cyclophostin-like inhibitor cyc8b (see paper)
30% identity, 86% coverage: 26:283/300 of query aligns to 16:274/284 of 7zm2A
7zm1A Crystal structure of hsad from mycobacterium tuberculosis in complex with cyclophostin-like inhibitor cyc7b (see paper)
30% identity, 86% coverage: 26:283/300 of query aligns to 16:274/284 of 7zm1A
5jzsB Hsad bound to 3,5-dichloro-4-hydroxybenzoic acid (see paper)
30% identity, 86% coverage: 26:283/300 of query aligns to 16:274/284 of 5jzsB
5jz9A Crystal structure of hsad bound to 3,5-dichloro-4- hydroxybenzenesulphonic acid (see paper)
30% identity, 86% coverage: 26:283/300 of query aligns to 16:274/284 of 5jz9A
P9WNH5 4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase; 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase; HOPDA hydrolase; Meta-cleavage product hydrolase; MCP hydrolase; EC 3.7.1.17; EC 3.7.1.8 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
30% identity, 86% coverage: 26:283/300 of query aligns to 22:280/291 of P9WNH5
5jzbA Crystal structure of hsad bound to 3,5-dichlorobenzene sulphonamide (see paper)
30% identity, 86% coverage: 26:283/300 of query aligns to 16:274/282 of 5jzbA
2wugA Crystal structure of s114a mutant of hsad from mycobacterium tuberculosis in complex with hopda (see paper)
30% identity, 86% coverage: 26:283/300 of query aligns to 16:274/283 of 2wugA
2wufB Crystal structure of s114a mutant of hsad from mycobacterium tuberculosis in complex with 4,9dsha (see paper)
30% identity, 86% coverage: 26:283/300 of query aligns to 16:274/282 of 2wufB
2wueB Crystal structure of s114a mutant of hsad from mycobacterium tuberculosis in complex with hopoda (see paper)
30% identity, 86% coverage: 26:283/300 of query aligns to 16:274/282 of 2wueB
P47229 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase; HOPDA hydrolase; 2,6-dioxo-6-phenylhexa-3-enoate hydrolase; EC 3.7.1.8 from Paraburkholderia xenovorans (strain LB400) (see paper)
27% identity, 89% coverage: 27:292/300 of query aligns to 22:285/286 of P47229
2og1A Crystal structure of bphd, a c-c hydrolase from burkholderia xenovorans lb400 (see paper)
27% identity, 89% coverage: 27:292/300 of query aligns to 21:284/285 of 2og1A
2rhwA Crystal structure of the s112a mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400, in complex with 3,10-di-fluoro hopda (see paper)
27% identity, 89% coverage: 27:292/300 of query aligns to 19:282/283 of 2rhwA
2rhtA Crystal structure of the s112a mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400, in complex with 3-cl hopda (see paper)
27% identity, 89% coverage: 27:292/300 of query aligns to 19:282/283 of 2rhtA
2puhA Crystal structure of the s112a mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400, in complex with its substrate hopda (see paper)
27% identity, 89% coverage: 27:292/300 of query aligns to 19:282/283 of 2puhA
Q9AQM4 2-hydroxy-6-oxo-6-(2'-aminophenyl)hexa-2,4-dienoic acid hydrolase; HOPDA; EC 3.7.1.13 from Pseudomonas resinovorans (see paper)
27% identity, 93% coverage: 15:294/300 of query aligns to 13:284/290 of Q9AQM4
2pujA Crystal structure of the s112a/h265a double mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400, in complex with its substrate hopda (see paper)
26% identity, 89% coverage: 27:292/300 of query aligns to 19:282/283 of 2pujA
4lyeA Crystal structure of the s105a mutant of a c-c hydrolase, dxnb2 from sphingomonas wittichii rw1, in complex with substrate hopda (see paper)
27% identity, 90% coverage: 21:289/300 of query aligns to 8:272/276 of 4lyeA
4lxiA Crystal structure of the s105a mutant of a carbon-carbon bond hydrolase, dxnb2 from sphingomonas wittichii rw1, in complex with 5, 8-dif hopda (see paper)
27% identity, 90% coverage: 21:289/300 of query aligns to 8:272/276 of 4lxiA
>CCNA_02478 FitnessBrowser__Caulo:CCNA_02478
MAQSKPFMFAAYPREALMTEQWITVGDLRIRYVDSGGEGIPVFLLSGIGASLEFWSNQLE
ALGERLRLIAWDYPGHGLSDGDGRSHDPDRYAAFALDVMNALGLERVVAVGNSLGGAIAL
RMAGLAPDRVAGLMLASPAMMGPEVFLPFRLMSLPLLGELMSKPGKLSVEQQIAALFHDS
ASATEALRRIVWRNVHKDGAPQALLATMRETLWIGGVRKVHWARSRALLKSATCPILFIH
GKQDVVLPFQQSIDCAKLNPRAEVKVIDGCGHTPQIEIPETFNAEMKAFARRVDEDHATS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory