Comparing CCNA_02488 FitnessBrowser__Caulo:CCNA_02488 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
Q29551 Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial; SCOT; 3-oxoacid CoA-transferase 1; Somatic-type succinyl-CoA:3-oxoacid CoA-transferase; SCOT-s; Succinate-coenzyme A transferase; Succinyl-CoA:3-oxoacid CoA transferase; EC 2.8.3.5 from Sus scrofa (Pig) (see 3 papers)
53% identity, 95% coverage: 7:238/245 of query aligns to 40:288/520 of Q29551
Sites not aligning to the query:
1o9lB Succinate:coenzyme-a transferase (pig heart)
53% identity, 93% coverage: 7:235/245 of query aligns to 1:246/425 of 1o9lB
Sites not aligning to the query:
1o9lA Succinate:coenzyme-a transferase (pig heart)
53% identity, 93% coverage: 7:235/245 of query aligns to 1:246/468 of 1o9lA
3k6mC Dynamic domains of succinyl-coa:3-ketoacid-coenzyme a transferase from pig heart. (see paper)
53% identity, 93% coverage: 7:235/245 of query aligns to 1:246/466 of 3k6mC
Sites not aligning to the query:
3oxoE Succinyl-coa:3-ketoacid coa transferase from pig heart covalently bound to coa (see paper)
53% identity, 93% coverage: 7:235/245 of query aligns to 1:246/462 of 3oxoE
Sites not aligning to the query:
6lp1C Crystal structure of acetate:succinate coa transferase (asct) from trypanosoma brucei. (see paper)
48% identity, 89% coverage: 23:240/245 of query aligns to 18:254/469 of 6lp1C
1k6dB Crystal structure of acetate coa-transferase alpha subunit (see paper)
45% identity, 89% coverage: 5:222/245 of query aligns to 1:216/219 of 1k6dB
2ahvA Crystal structure of acyl-coa transferase from e. Coli o157:h7 (ydif)- thioester complex with coa- 1 (see paper)
24% identity, 64% coverage: 63:220/245 of query aligns to 82:248/512 of 2ahvA
Sites not aligning to the query:
6co9A Crystal structure of rhodococcus jostii rha1 ipdab cochea-coa complex (see paper)
24% identity, 76% coverage: 19:204/245 of query aligns to 15:213/295 of 6co9A
Q0S7P9 Cholesterol ring-cleaving hydrolase IpdA subunit; (3E)-2-(2-carboxylatoethyl)-3-methyl-6-oxocyclohex-1-ene-1-carboxyl-CoA hydrolase alpha subunit; COCHEA-CoA hydrolase alpha subunit; EC 4.1.99.- from Rhodococcus jostii (strain RHA1) (see paper)
24% identity, 74% coverage: 24:204/245 of query aligns to 21:214/296 of Q0S7P9
>CCNA_02488 FitnessBrowser__Caulo:CCNA_02488
MERPMKSKIYESAAAALEGVVFDGMTLMSGGFGLSGNPETLIPALKDTGVKALTVISNNC
GADGFGLWMLLNNGQIRKMVSSYVGENKLFEQLYLSGELELELNPQGTLAERIRAGGAGI
PAFYTKTGVGTVVAEGKPVETFEGEPYLRETWLRADLSIVKAWKADPEGNLVFRMTARNF
NPVMATAGKVTIVEVEEIVEAGELDANAIHTPGIYVDRIVKSTINEKRIEKLTTRPREIH
AGETV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory