Comparing CCNA_02489 FitnessBrowser__Caulo:CCNA_02489 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
1o9lA Succinate:coenzyme-a transferase (pig heart)
57% identity, 95% coverage: 5:209/215 of query aligns to 250:454/468 of 1o9lA
Sites not aligning to the query:
3k6mC Dynamic domains of succinyl-coa:3-ketoacid-coenzyme a transferase from pig heart. (see paper)
57% identity, 95% coverage: 5:209/215 of query aligns to 249:453/466 of 3k6mC
Sites not aligning to the query:
8i3yD Crystal structure of asct from trypanosoma brucei in complex with succinyl-coa.
60% identity, 96% coverage: 5:211/215 of query aligns to 257:461/471 of 8i3yD
Sites not aligning to the query:
8i40A Crystal structure of asct from trypanosoma brucei in complex with coa.
60% identity, 96% coverage: 5:211/215 of query aligns to 253:457/467 of 8i40A
Q29551 Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial; SCOT; 3-oxoacid CoA-transferase 1; Somatic-type succinyl-CoA:3-oxoacid CoA-transferase; SCOT-s; Succinate-coenzyme A transferase; Succinyl-CoA:3-oxoacid CoA transferase; EC 2.8.3.5 from Sus scrofa (Pig) (see 3 papers)
56% identity, 95% coverage: 5:209/215 of query aligns to 302:506/520 of Q29551
Sites not aligning to the query:
8i3yA Crystal structure of asct from trypanosoma brucei in complex with succinyl-coa.
60% identity, 95% coverage: 7:211/215 of query aligns to 249:451/459 of 8i3yA
Sites not aligning to the query:
3oxoE Succinyl-coa:3-ketoacid coa transferase from pig heart covalently bound to coa (see paper)
58% identity, 93% coverage: 11:209/215 of query aligns to 251:449/462 of 3oxoE
>CCNA_02489 FitnessBrowser__Caulo:CCNA_02489
MAWTRDEMAARAARELKNGFYVNLGIGIPTLVANHIPEGVHVTLQSENGMLGMGPFPYED
EADPDLINAGKQTITKLPTSSFFDSAQSFAMIRGGHIDLTVLGAMEVAQNGDIANWTIPG
KMVKGMGGAMDLVAGVKRVIVVMDHANKAGQSKVLKRCALPLTGAACVDMVITDLCVFDL
DRKGGGLTLIELAPEVTLDEVKAKTAADFDAGAFA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory