Comparing CCNA_02491 FitnessBrowser__Caulo:CCNA_02491 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P00437 Protocatechuate 3,4-dioxygenase beta chain; 3,4-PCD; EC 1.13.11.3 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
48% identity, 96% coverage: 7:231/235 of query aligns to 12:238/239 of P00437
Sites not aligning to the query:
4whrB Anhydride reaction intermediate trapped in protocatechuate 3,4- dioxygenase (pseudomonas putida) at ph 8.5 (see paper)
48% identity, 96% coverage: 7:231/235 of query aligns to 11:237/238 of 4whrB
Sites not aligning to the query:
4whqB Alkylperoxo reaction intermediate trapped in protocatechuate 3,4- dioxygenase (pseudomonas putida) at ph 6.5 (see paper)
48% identity, 96% coverage: 7:231/235 of query aligns to 11:237/238 of 4whqB
3pckM Structure of protocatechuate 3,4-dioxygenase complexed with 6- hydroxynicotinic acid n-oxide (see paper)
49% identity, 95% coverage: 7:230/235 of query aligns to 11:233/233 of 3pckM
3pcjM Structure of protocatechuate 3,4-dioxygenase complexed with 2- hydroxyisonicotinic acid n-oxide (see paper)
49% identity, 95% coverage: 7:230/235 of query aligns to 11:233/233 of 3pcjM
3pciM Structure of protocatechuate 3,4-dioxygenase complexed with 3-iodo-4- hydroxybenzoate (see paper)
49% identity, 95% coverage: 7:230/235 of query aligns to 11:233/233 of 3pciM
3pchM Structure of protocatechuate 3,4-dioxygenase complexed with 3-chloro- 4-hydroxybenzoate (see paper)
49% identity, 95% coverage: 7:230/235 of query aligns to 11:233/233 of 3pchM
3pcgM Structure of protocatechuate 3,4-dioxygenase complexed with the inhibitor 4-hydroxyphenylacetate (see paper)
49% identity, 95% coverage: 7:230/235 of query aligns to 11:233/233 of 3pcgM
3pcfM Structure of protocatechuate 3,4-dioxygenase complexed with 3-fluro-4- hydroxybenzoate (see paper)
49% identity, 95% coverage: 7:230/235 of query aligns to 11:233/233 of 3pcfM
3pceM Structure of protocatechuate 3,4-dioxygenase complexed with 3- hydroxyphenylacetate (see paper)
49% identity, 95% coverage: 7:230/235 of query aligns to 11:233/233 of 3pceM
3pcbM Structure of protocatechuate 3,4-dioxygenase complexed with 3- hydroxybenzoate (see paper)
49% identity, 95% coverage: 7:230/235 of query aligns to 11:233/233 of 3pcbM
4whqF Alkylperoxo reaction intermediate trapped in protocatechuate 3,4- dioxygenase (pseudomonas putida) at ph 6.5 (see paper)
49% identity, 95% coverage: 7:230/235 of query aligns to 11:236/236 of 4whqF
3lxvM Tyrosine 447 of protocatechuate 3,4-dioxygenase controls efficient progress through catalysis
48% identity, 96% coverage: 7:231/235 of query aligns to 11:237/238 of 3lxvM
3lktM Tyrosine 447 of protocatechuate 3,4-dioxygenase controls efficient progress through catalysis
48% identity, 96% coverage: 7:231/235 of query aligns to 11:237/238 of 3lktM
3mv4M Axial ligand swapping in double mutant maintains intradiol-cleavage chemistry in protocatechuate 3,4-dioxygenase
48% identity, 96% coverage: 7:231/235 of query aligns to 11:237/238 of 3mv4M
3mi5M Axial ligand swapping in double mutant maintains intradiol-cleavage chemistry in protocatechuate 3,4-dioxygenase
48% identity, 96% coverage: 7:231/235 of query aligns to 11:237/238 of 3mi5M
3mflM Axial ligand swapping in double mutant maintains intradiol-cleavage chemistry in protocatechuate 3,4-dioxygenase
48% identity, 96% coverage: 7:231/235 of query aligns to 11:237/238 of 3mflM
2buqB Crystal structure of wild-type protocatechuate 3,4-dioxygenase from acinetobacter sp. Adp1 in complex with catechol (see paper)
43% identity, 97% coverage: 6:232/235 of query aligns to 8:236/238 of 2buqB
2bumB Crystal structure of wild-type protocatechuate 3,4-dioxygenase from acinetobacter sp. Adp1 (see paper)
43% identity, 97% coverage: 6:232/235 of query aligns to 8:236/238 of 2bumB
1eocB Crystal structure of acinetobacter sp. Adp1 protocatechuate 3,4- dioxygenase in complex with 4-nitrocatechol (see paper)
43% identity, 97% coverage: 6:232/235 of query aligns to 8:236/238 of 1eocB
>CCNA_02491 FitnessBrowser__Caulo:CCNA_02491
MNPNFKREDAGQPPSLHAPYASTVPRSPRQPLVRIPHTLTETTGPSNAWPRLMGGAMADL
TTQHKAMPQGQRIIVSGRVLDEDGRPVPNTVMEIWQANAAGRYIHKKDQWDAPLDPNFTG
AGRVITDDEGRYQFVSIRPGAYPWGNHHNAWRPAHIHLSLLGPAFATRLVTQMYFPDDPL
IEIDPIANAVPLPYRQRLVSRFDIEATKPNWALGYLFDVVLRGRDQTPFEDDHHA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory