Comparing CCNA_02494 FitnessBrowser__Caulo:CCNA_02494 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2xuaH Crystal structure of the enol-lactonase from burkholderia xenovorans lb400 (see paper)
38% identity, 66% coverage: 1:259/393 of query aligns to 1:261/261 of 2xuaH
6eb3B Structural and enzymatic characterization of an esterase from a metagenomic library
31% identity, 66% coverage: 1:258/393 of query aligns to 1:264/268 of 6eb3B
6eb3C Structural and enzymatic characterization of an esterase from a metagenomic library
31% identity, 66% coverage: 1:258/393 of query aligns to 1:258/262 of 6eb3C
6eb3A Structural and enzymatic characterization of an esterase from a metagenomic library
31% identity, 66% coverage: 1:258/393 of query aligns to 1:261/265 of 6eb3A
4uheA Structural studies of a thermophilic esterase from thermogutta terrifontis (malate bound) (see paper)
31% identity, 55% coverage: 44:260/393 of query aligns to 48:270/272 of 4uheA
Sites not aligning to the query:
4uhfA Structural studies of a thermophilic esterase from thermogutta terrifontis (l37a mutant with butyrate bound) (see paper)
31% identity, 55% coverage: 44:260/393 of query aligns to 48:270/278 of 4uhfA
Sites not aligning to the query:
4uhdA Structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) (see paper)
31% identity, 55% coverage: 44:260/393 of query aligns to 48:270/274 of 4uhdA
Sites not aligning to the query:
5h3hB Esterase (eaest) from exiguobacterium antarcticum (see paper)
28% identity, 59% coverage: 8:238/393 of query aligns to 10:246/269 of 5h3hB
Sites not aligning to the query:
O33472 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; EC 1.13.11.47 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
26% identity, 64% coverage: 8:257/393 of query aligns to 8:262/264 of O33472
6brtA F-box protein cth with hydrolase (see paper)
26% identity, 63% coverage: 14:259/393 of query aligns to 30:284/285 of 6brtA
Q10QA5 Strigolactone esterase D14; Protein DWARF 14; Protein DWARF 88; Protein HIGH-TILLERING DWARF 2; EC 3.1.-.- from Oryza sativa subsp. japonica (Rice) (see 4 papers)
26% identity, 63% coverage: 14:259/393 of query aligns to 63:317/318 of Q10QA5
6ap8A Crystal structure of rice d14 bound to 2-(2-methyl-3-nitroanilino) benzoic acid (see paper)
26% identity, 63% coverage: 14:259/393 of query aligns to 11:265/266 of 6ap8A
5dj5A Crystal structure of rice dwarf14 in complex with synthetic strigolactone gr24 (see paper)
26% identity, 63% coverage: 14:259/393 of query aligns to 11:265/266 of 5dj5A
Q8NFV4 sn-1-specific diacylglycerol lipase ABHD11; Alpha/beta hydrolase domain-containing protein 11; Abhydrolase domain-containing protein 11; Williams-Beuren syndrome chromosomal region 21 protein; EC 3.1.1.116 from Homo sapiens (Human) (see paper)
26% identity, 63% coverage: 12:257/393 of query aligns to 48:305/306 of Q8NFV4
5zhtA Crystal structure of osd14 in complex with covalently bound kk073 (see paper)
26% identity, 63% coverage: 14:259/393 of query aligns to 10:264/265 of 5zhtA
5zhrA Crystal structure of osd14 in complex with covalently bound kk094 (see paper)
26% identity, 63% coverage: 14:259/393 of query aligns to 10:264/265 of 5zhrA
5yz7A Crystal structure of osd14 in complex with d-ring-opened 7'-carba-4bd (see paper)
26% identity, 63% coverage: 14:259/393 of query aligns to 10:264/265 of 5yz7A
5zhsA Crystal structure of osd14 in complex with covalently bound kk052 (see paper)
26% identity, 63% coverage: 14:259/393 of query aligns to 9:263/264 of 5zhsA
4ihaA Crystal structure of rice dwarf14 (d14) in complex with a gr24 hydrolysis intermediate (see paper)
26% identity, 63% coverage: 14:259/393 of query aligns to 13:267/268 of 4ihaA
6kxhB Alp1u_y247f mutant in complex with fluostatin c (see paper)
30% identity, 32% coverage: 8:133/393 of query aligns to 27:149/294 of 6kxhB
Sites not aligning to the query:
>CCNA_02494 FitnessBrowser__Caulo:CCNA_02494
MPFAVSQGARIYWRTDGAADKPLLVLLNSIGCDLSLHDPVTPLLTPDFRVLRIDTRGHGA
SDAPSGDYSLDLLADDVLAVMDAAGAAKATICGTSLGGMIAMALASRAPDRVEALVLACT
SPAMDSSSWEQRLAVIRAEGLSAIVEAVMSRFFSDDFRALHPEVVETVRAGMLAQNPDGY
CGCGAAIRDMALLDRLPKIAAPTLVLTGSKDVATPFEGHADRIVAAVPGARHAVIEAAHL
PSLEAPAAFAGAVRGFLAEVLHGAAVSDAKAVLFEAGLVTRRRVLGDAWVDKSLAKRTAF
TADYQAMITRYAWNEIWGRPGLDHRTRRLLVLAICASLARWEEFRLHVRAGLEQGGFTQD
ELKEVLMQIAIYAGVPAANTAFTEAADVMSELG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory