Comparing CCNA_02540 FitnessBrowser__Caulo:CCNA_02540 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
38% identity, 91% coverage: 35:429/432 of query aligns to 43:427/442 of P54968
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
36% identity, 92% coverage: 32:429/432 of query aligns to 2:376/380 of P54955
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
36% identity, 90% coverage: 40:429/432 of query aligns to 48:423/440 of O04373
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
34% identity, 92% coverage: 34:429/432 of query aligns to 10:388/389 of 4ewtA
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
31% identity, 87% coverage: 32:407/432 of query aligns to 14:374/398 of 6slfA
3ramA Crystal structure of hmra (see paper)
25% identity, 89% coverage: 47:432/432 of query aligns to 25:376/391 of 3ramA
3rzaA Crystal structure of a tripeptidase (sav1512) from staphylococcus aureus subsp. Aureus mu50 at 2.10 a resolution
25% identity, 41% coverage: 225:401/432 of query aligns to 183:353/373 of 3rzaA
Sites not aligning to the query:
>CCNA_02540 FitnessBrowser__Caulo:CCNA_02540
MIGRVSTLALVAGLAMGAPAMAAPSAAKVEAAAKAVQPKVVAWRRDIHENPELGNQEVRT
AALIAKELKALGIEVREGVGKTGVVGVLKGGKPGKVVALRADMDALPVEEKTGLPFASKV
KATWEGRTVPVMHACGHDTHVAMLLGAATVLAGMKQDIQGTVVFIFQPAEEGPPAGEEGG
AKLMIRDGALDNPKVDAVFGVHIGPGDPHELNYRPEGFYASSDRITITVKGRQTHGARPW
AGIDMASVAADIIQATNQIAARQVDVGVSPSVLTIATINMGFRQNIIPEDLKMEGTMRTF
SKERREDLIARMQKSVTAIGDRYGAKAEVAFTQPYPVTYNDPALSKWVKGTLEKASPGKV
DDNAALVTGAEDFSMYAEKVPGVFIQLGGRKADVPRETVPVNHSPYFDVDEAVFETGVKA
HAFMALDYLAKK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory