Comparing CCNA_02569 FitnessBrowser__Caulo:CCNA_02569 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4hojA Crystal structure of glutathione transferase homolog from neisseria gonorrhoeae, target efi-501841, with bound glutathione
27% identity, 90% coverage: 13:201/209 of query aligns to 11:186/197 of 4hojA
Sites not aligning to the query:
3qawA Crystal structure of a glutathione-s-transferase from antarctic clam laternula elliptica in a complex with glutathione (see paper)
28% identity, 76% coverage: 10:167/209 of query aligns to 7:168/219 of 3qawA
Q9WVL0 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Mus musculus (Mouse)
29% identity, 81% coverage: 12:180/209 of query aligns to 17:183/216 of Q9WVL0
2cz2A Crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-1 crystal)
29% identity, 81% coverage: 12:180/209 of query aligns to 14:180/212 of 2cz2A
Sites not aligning to the query:
4jbbA Crystal structure of glutathione s-transferase a6tby7(target efi- 507184) from klebsiella pneumoniae mgh 78578, gsh complex
34% identity, 73% coverage: 10:161/209 of query aligns to 13:167/208 of 4jbbA
4qq7A Crystal structure of putative stringent starvation protein a from burkholderia cenocepacia with bound glutathione
25% identity, 95% coverage: 3:201/209 of query aligns to 3:193/204 of 4qq7A
8ax0A Crystal structure of trametes versicolor glutathione transferase omega 3s in complex with sodium nitroprusside (see paper)
28% identity, 82% coverage: 2:173/209 of query aligns to 3:172/241 of 8ax0A
Sites not aligning to the query:
8awzA Crystal structure of trametes versicolor glutathione transferase omega 3s in complex with dinitrosyl glutathionyl iron complex (dngic) (see paper)
28% identity, 82% coverage: 2:173/209 of query aligns to 3:172/241 of 8awzA
6hpeA Crystal structure of glutathione transferase omega 3s from trametes versicolor in complex with the glutathione adduct of phenethyl- isothiocyanate (see paper)
28% identity, 82% coverage: 2:173/209 of query aligns to 3:172/241 of 6hpeA
6f6aA Crystal structure of glutathione transferase omega 3s from trametes versicolor in complex with dihydrowogonin from wild-cherry extract (see paper)
28% identity, 82% coverage: 2:173/209 of query aligns to 3:172/241 of 6f6aA
Sites not aligning to the query:
6f69A Crystal structure of glutathione transferase omega 3s from trametes versicolor in complex with 2,3,4-trihydroxybenzophenone (see paper)
28% identity, 82% coverage: 2:173/209 of query aligns to 3:172/241 of 6f69A
6f68A Crystal structure glutathione transferase omega 3s from trametes versicolor in complex with 2,4,4'-trihydroxybenzophenone (see paper)
28% identity, 82% coverage: 2:173/209 of query aligns to 3:172/241 of 6f68A
6f67A Crystal structure of glutathione transferase omega 3s from trametes versicolor in complex with 3,4-dihydroxybenzophenone (see paper)
28% identity, 82% coverage: 2:173/209 of query aligns to 3:172/241 of 6f67A
6f66A Crystal structure of glutathione transferase omega 3s from trametes versicolor in complex with 2,4-dihydroxybenzophenone (see paper)
28% identity, 82% coverage: 2:173/209 of query aligns to 3:172/241 of 6f66A
6f4kA Crystal structure of glutathione transferase omega 3s from trametes versicolor in complex with hexyl-glutathione (see paper)
28% identity, 82% coverage: 2:173/209 of query aligns to 3:172/241 of 6f4kA
6f4fA Crystal structure of glutathione transferase omega 3s from trametes versicolor in complex with glutathionyl-s-dinitrobenzene (see paper)
28% identity, 82% coverage: 2:173/209 of query aligns to 3:172/241 of 6f4fA
Sites not aligning to the query:
8ax1A Crystal structure of trametes versicolor glutathione transferase omega 3s in complex with hydroxy-tetranitro-nitrosyl-ruthenate (see paper)
28% identity, 82% coverage: 2:173/209 of query aligns to 2:171/240 of 8ax1A
Sites not aligning to the query:
6f51A Crystal structure of glutathione transferase omega 3s from trametes versicolor in complex with glutathionyl-phenylacetophenone (see paper)
28% identity, 82% coverage: 2:173/209 of query aligns to 2:171/240 of 6f51A
O43708 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Homo sapiens (Human) (see 10 papers)
29% identity, 81% coverage: 12:180/209 of query aligns to 17:183/216 of O43708
1fw1A Glutathione transferase zeta/maleylacetoacetate isomerase (see paper)
28% identity, 81% coverage: 12:180/209 of query aligns to 13:179/208 of 1fw1A
Sites not aligning to the query:
>CCNA_02569 FitnessBrowser__Caulo:CCNA_02569
MELVIGTKRWSSWSLRPWLALKRAGVDFTELEVALRRGEATGDEIGCISPSRLAPALRDG
DLVIWDSLAICEYLAERYPDAKLWPDDPVLRALGRSACAEMHSGFQALRGECPMALDEPP
RKLDLSEATQKNVRRIVALWTGLLARSHGPFLLGDWSIADAFYTPVATRFRTYDVRLADY
GDAGAAQGYSDRLLQTPEFLEWERAAQAG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory