Comparing CCNA_02614 FitnessBrowser__Caulo:CCNA_02614 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
3lzkC The crystal structure of a probably aromatic amino acid degradation protein from sinorhizobium meliloti 1021
71% identity, 99% coverage: 1:332/335 of query aligns to 7:338/343 of 3lzkC
6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
24% identity, 67% coverage: 40:263/335 of query aligns to 40:242/280 of 6j5xB
6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
24% identity, 67% coverage: 40:263/335 of query aligns to 40:242/280 of 6j5xA
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
24% identity, 58% coverage: 70:263/335 of query aligns to 52:243/290 of 8gstC
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
24% identity, 58% coverage: 70:263/335 of query aligns to 52:243/290 of 8gsrA
3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
24% identity, 47% coverage: 108:263/335 of query aligns to 76:226/265 of 3r6oA
>CCNA_02614 FitnessBrowser__Caulo:CCNA_02614
MKLASLKGGRDGRLVVVSNDLAWFTDAGTIAPTLQAALDNWERCGPMLAGLAESLEHGAV
PKERFHEHEALSPLPRAYQWVDGSAYVNHVQLVRKARGAEMPESFWTDPLMYQGASDGFL
APRDPIPLADASWGCDLEGEVAVIVDDVPLGATREEALAAIRLVMLCNDVSLRNLIPGEL
AKGFGFLQSKPASAFSPVAVSPDALGEAWKGGKLHGALLVELDGKDFGRADAGVDMTFDF
GTLVAHAAKTRSLCAGTIVGSGTVSNRDADGGPGKPISEGGLGYSCLAEVRTVETLLHGA
PKTPFLLGGDTIRIEMKDAKGHSIFGAIEQTVERI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory