Comparing CCNA_02734 FitnessBrowser__Caulo:CCNA_02734 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8i04A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with serine (see paper)
54% identity, 86% coverage: 27:276/290 of query aligns to 5:254/258 of 8i04A
1t3dA Crystal structure of serine acetyltransferase from e.Coli at 2.2a (see paper)
54% identity, 86% coverage: 27:276/290 of query aligns to 9:258/262 of 1t3dA
1ssqD Serine acetyltransferase- complex with cysteine (see paper)
52% identity, 86% coverage: 27:276/290 of query aligns to 5:254/257 of 1ssqD
4h7oA Crystal structure of serine acetyltransferase from vibrio cholerae o1 biovar el tor n16961
55% identity, 88% coverage: 25:278/290 of query aligns to 3:256/258 of 4h7oA
8i09A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with butyl gallate (see paper)
55% identity, 82% coverage: 27:265/290 of query aligns to 8:246/246 of 8i09A
8i06A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with coa (see paper)
56% identity, 81% coverage: 27:262/290 of query aligns to 9:244/244 of 8i06A
3gvdI Crystal structure of serine acetyltransferase cyse from yersinia pestis
52% identity, 89% coverage: 19:276/290 of query aligns to 4:261/272 of 3gvdI
4hzdA Crystal structure of serine acetyltransferase in complex with coenzyme a from brucella abortus strain s19 (see paper)
50% identity, 85% coverage: 22:267/290 of query aligns to 4:249/250 of 4hzdA
1sstA Serine acetyltransferase- complex with coa (see paper)
52% identity, 81% coverage: 27:262/290 of query aligns to 5:233/233 of 1sstA
6wyeA Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) (see paper)
49% identity, 89% coverage: 22:278/290 of query aligns to 5:260/261 of 6wyeA
4n69A Soybean serine acetyltransferase complexed with serine (see paper)
55% identity, 83% coverage: 22:262/290 of query aligns to 3:243/243 of 4n69A
7ra4A Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) in complex with serine (see paper)
52% identity, 81% coverage: 27:262/290 of query aligns to 8:243/243 of 7ra4A
4n6bA Soybean serine acetyltransferase complexed with coa (see paper)
54% identity, 82% coverage: 24:262/290 of query aligns to 1:233/233 of 4n6bA
7bw9A Crystal structure of serine acetyltransferase isoform 3 in complex with cysteine from entamoeba histolytica
37% identity, 54% coverage: 93:248/290 of query aligns to 97:252/280 of 7bw9A
3q1xA Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-serine (see paper)
31% identity, 75% coverage: 36:253/290 of query aligns to 52:265/267 of 3q1xA
3p47A Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-cysteine (see paper)
31% identity, 75% coverage: 36:253/290 of query aligns to 54:267/270 of 3p47A
G3XD01 UDP-2-acetamido-3-amino-2,3-dideoxy-D-glucuronate N-acetyltransferase; UDP-D-GlcNAc3NA N-acetyltransferase; UDP-2-acetamido-3-amino-2,3-dideoxy-alpha-D-glucuronic acid 3-N-acetyltransferase; EC 2.3.1.201 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
31% identity, 36% coverage: 160:262/290 of query aligns to 27:152/191 of G3XD01
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
30% identity, 33% coverage: 168:262/290 of query aligns to 77:181/201 of 1krvA
Sites not aligning to the query:
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
30% identity, 33% coverage: 168:262/290 of query aligns to 77:181/201 of 1kruA
Sites not aligning to the query:
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
30% identity, 33% coverage: 168:262/290 of query aligns to 77:181/200 of 1krrA
Sites not aligning to the query:
>CCNA_02734 FitnessBrowser__Caulo:CCNA_02734
MLASRLGREIPMPKHLEVVTSDTETPVWVALRNQAEHAAKAEPALASLLNAVILSHDNLA
DALTFQLARKLGDQEMRAMTAREFAADAFEDDLSIVEAAEADLKAVFERDPACKGYVQPF
LFFKGFLALQTHRVSHWLWNQGRETLAFYLQSRSSEVFQVDINPAAKIGKGVFIDHGTGI
VIGETAVVGDDVSMLHGVTLGGTGAERGDRHPKIGKGVLLGAGAKVLGNITVGDYAKVAS
GSVVLRPVPAHCTAAGVPARLVNCPTCEEPAKTMDHTLAEAVYSTSSYEI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory