Comparing CCNA_02900 FitnessBrowser__Caulo:CCNA_02900 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
37% identity, 92% coverage: 29:431/437 of query aligns to 6:392/398 of 6slfA
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
33% identity, 86% coverage: 46:423/437 of query aligns to 13:378/380 of P54955
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
31% identity, 89% coverage: 50:437/437 of query aligns to 23:389/389 of 4ewtA
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 84% coverage: 48:413/437 of query aligns to 53:401/440 of O04373
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 85% coverage: 43:413/437 of query aligns to 52:405/442 of P54968
Sites not aligning to the query:
3ramA Crystal structure of hmra (see paper)
27% identity, 66% coverage: 29:317/437 of query aligns to 5:260/391 of 3ramA
Sites not aligning to the query:
>CCNA_02900 FitnessBrowser__Caulo:CCNA_02900
MKSLFAASALALLIATAAQAGPLNVPATQKVISAQLDRDYPALEALYKDIHAHPELGFQE
VETAKKLAAQMRALGFTVTEGVGKTGVVAVLKNGEGPKVLIRTELDGLPMQEKSGLAWAS
QATATWNGEKVFVAHACGHDIHMAAWVGAARQLVAMKAKWKGTLVFVAQPSEETVRGARA
MLDDGLWDKIGGKPDYGFALHVGSGPAGEVYYKAGVLTSTSDGLDITFNGRGGHGSMPSA
TIDPVLMAARFTVDVQSVISREKDPSAFGVVTVGSIQAGSAGNIIPDKARVRGTIRTQDN
AVREKILDGVRRTVKAVTDMAGAPPADLKLTPGGKMVVNDAALTDRTAVVFKAAFGARAV
AQDKPGSASEDYSEFVLAGVPSVYFAIGGSDPAELAKAKAEGREPPVNHSPYFAPVAEPT
IRTGVEAMTLAVLNVLK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory