SitesBLAST
Comparing CCNA_02929 FitnessBrowser__Caulo:CCNA_02929 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4cpdA Alcohol dehydrogenase tadh from thermus sp. Atn1
43% identity, 99% coverage: 1:344/346 of query aligns to 1:344/346 of 4cpdA
- active site: C38 (= C38), G39 (= G39), S40 (= S40), H43 (= H43), H59 (= H60), E60 (= E61), C89 (= C90), C92 (= C93), C95 (= C96), C103 (= C104), G107 (≠ Q108), D152 (= D152), T156 (= T156), K340 (= K340)
- binding nicotinamide-adenine-dinucleotide: G39 (= G39), S40 (= S40), T156 (= T156), G178 (= G178), P179 (= P179), V180 (≠ I180), D200 (= D200), R201 (≠ P201), R205 (= R205), A243 (= A241), V244 (= V242), V266 (≠ I264), V268 (= V266), L292 (≠ T290), A293 (≠ C291), F333 (= F331)
- binding zinc ion: C38 (= C38), H59 (= H60), C89 (= C90), C92 (= C93), C95 (= C96), C103 (= C104), D152 (= D152)
5ylnA Zinc dependent alcohol dehydrogenase 2 from streptococcus pneumonia - apo form
33% identity, 99% coverage: 1:343/346 of query aligns to 5:341/348 of 5ylnA
6schC Nadh-dependent variant of cbadh (see paper)
31% identity, 100% coverage: 1:345/346 of query aligns to 1:341/355 of 6schC
- active site: C37 (= C38), S39 (= S40), H42 (= H43), H59 (= H60), D150 (= D152)
- binding nicotinamide-adenine-dinucleotide: T38 (≠ G39), W110 (≠ Y112), D150 (= D152), T154 (= T156), G174 (= G176), V178 (≠ I180), D198 (= D200), Y199 (≠ P201), R200 (≠ L202), A242 (= A241), G243 (≠ V242), G244 (= G243), N266 (≠ G265), Y267 (≠ V266), K340 (≠ T344)
- binding zinc ion: C37 (= C38), H59 (= H60), D150 (= D152)
1kevA Structure of NADP-dependent alcohol dehydrogenase (see paper)
31% identity, 100% coverage: 1:345/346 of query aligns to 1:341/351 of 1kevA
- active site: C37 (= C38), T38 (≠ G39), S39 (= S40), H42 (= H43), H59 (= H60), E60 (= E61), D89 (≠ C90), S92 (≠ C93), V95 (≠ C96), S103 (≠ E105), D150 (= D152), T154 (= T156)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: T38 (≠ G39), D150 (= D152), I175 (≠ L177), G176 (= G178), V178 (≠ I180), S199 (≠ P201), R200 (≠ L202), Y218 (≠ L217), A242 (= A241), G244 (= G243), N266 (≠ G265), Y267 (≠ V266), K340 (≠ T344)
- binding zinc ion: C37 (= C38), H59 (= H60), D150 (= D152)
Sites not aligning to the query:
P25984 NADP-dependent isopropanol dehydrogenase; CbADH; EC 1.1.1.80 from Clostridium beijerinckii (Clostridium MP) (see 3 papers)
31% identity, 100% coverage: 1:345/346 of query aligns to 1:341/351 of P25984
3fsrA Chimera of alcohol dehydrogenase by exchange of the cofactor binding domain res 153-295 of t. Brockii adh by c. Beijerinckii adh (see paper)
30% identity, 99% coverage: 1:343/346 of query aligns to 1:349/352 of 3fsrA
- active site: C37 (= C38), T38 (≠ G39), S39 (= S40), H42 (= H43), H59 (= H60), E60 (= E61), D89 (≠ C90), T92 (≠ C93), V95 (≠ C96), S103 (≠ C104), D150 (= D152), T154 (= T156), K346 (= K340)
- binding zinc ion: C37 (= C38), H59 (= H60), D150 (= D152)
7uutA Ternary complex crystal structure of secondary alcohol dehydrogenases from the thermoanaerobacter ethanolicus mutants c295a and i86a provides better understanding of catalytic mechanism (see paper)
31% identity, 99% coverage: 1:343/346 of query aligns to 1:349/352 of 7uutA
- binding (2R)-pentan-2-ol: S39 (= S40), H59 (= H60), A85 (= A86), W110 (≠ Y112), D150 (= D152), C295 (= C291)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: C37 (= C38), T38 (≠ G39), S39 (= S40), D150 (= D152), T154 (= T156), G174 (= G176), G176 (= G178), P177 (= P179), V178 (≠ I180), S199 (≠ P201), R200 (≠ L202), A242 (= A241), G243 (≠ V242), G244 (= G243), I248 (≠ T247), V265 (≠ I264), N266 (≠ G265), Y267 (≠ V266), C295 (= C291), K340 (≠ R334)
- binding zinc ion: C37 (= C38), H59 (= H60), D150 (= D152)
7ux4A Crystallographic snapshots of ternary complexes of thermophilic secondary alcohol dehydrogenase from thermoanaerobacter pseudoethanolicus reveal the dynamics of ligand exchange and the proton relay network. (see paper)
32% identity, 92% coverage: 27:343/346 of query aligns to 24:347/350 of 7ux4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: D148 (= D152), T152 (= T156), G172 (= G176), I173 (≠ L177), G174 (= G178), P175 (= P179), V176 (≠ I180), R198 (≠ L202), G242 (= G243), V263 (≠ I264), N264 (≠ G265), Y265 (≠ V266), C293 (= C291)
- binding (1S,3S)-3-methylcyclohexan-1-ol: S37 (= S40), H57 (= H60), W108 (≠ Y112), D148 (= D152)
- binding zinc ion: C35 (= C38), H57 (= H60), E58 (= E61), D148 (= D152)
3fplA Chimera of alcohol dehydrogenase by exchange of the cofactor binding domain res 153-295 of c. Beijerinckii adh by t. Brockii adh (see paper)
34% identity, 76% coverage: 1:262/346 of query aligns to 1:263/351 of 3fplA
- active site: C37 (= C38), T38 (≠ G39), S39 (= S40), H42 (= H43), H59 (= H60), E60 (= E61), D89 (≠ C90), S92 (≠ C93), V95 (≠ C96), S103 (≠ E105), D150 (= D152), T154 (= T156)
- binding zinc ion: C37 (= C38), H59 (= H60), D150 (= D152)
Sites not aligning to the query:
7xy9A Cryo-em structure of secondary alcohol dehydrogenases tbsadh after carrier-free immobilization based on weak intermolecular interactions
33% identity, 92% coverage: 27:343/346 of query aligns to 27:342/344 of 7xy9A
- binding magnesium ion: H101 (≠ I101), H103 (≠ T103), H158 (≠ F159), C288 (= C291), G290 (≠ V293), G291 (≠ P294), L293 (vs. gap), R294 (≠ E296)
- binding zinc ion: C38 (= C38), H60 (= H60), E61 (= E61), D151 (= D152)
1ykfA NADP-dependent alcohol dehydrogenase from thermoanaerobium brockii (see paper)
31% identity, 99% coverage: 1:343/346 of query aligns to 1:349/352 of 1ykfA
- active site: C37 (= C38), T38 (≠ G39), S39 (= S40), H42 (= H43), H59 (= H60), E60 (= E61), D89 (≠ C90), T92 (≠ C93), V95 (≠ C96), S103 (≠ C104), D150 (= D152), T154 (= T156), K346 (= K340)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S39 (= S40), D150 (= D152), T154 (= T156), G174 (= G176), I175 (≠ L177), G176 (= G178), P177 (= P179), V178 (≠ I180), S199 (≠ P201), R200 (≠ L202), Y218 (≠ H218), I223 (≠ L223), N266 (≠ G265), Y267 (≠ V266)
- binding zinc ion: C37 (= C38), H59 (= H60), D150 (= D152)
1bxzB Crystal structure of a thermophilic alcohol dehydrogenase substrate complex from thermoanaerobacter brockii (see paper)
31% identity, 99% coverage: 1:343/346 of query aligns to 1:349/352 of 1bxzB
- active site: C37 (= C38), T38 (≠ G39), S39 (= S40), H42 (= H43), H59 (= H60), E60 (= E61), D89 (≠ C90), T92 (≠ C93), V95 (≠ C96), S103 (≠ C104), D150 (= D152), T154 (= T156), K346 (= K340)
- binding 2-butanol: H59 (= H60), D150 (= D152)
P14941 NADP-dependent isopropanol dehydrogenase; EC 1.1.1.80 from Thermoanaerobacter brockii (Thermoanaerobium brockii) (see 2 papers)
31% identity, 99% coverage: 1:343/346 of query aligns to 1:349/352 of P14941
2dfvA Hyperthermophilic threonine dehydrogenase from pyrococcus horikoshii (see paper)
30% identity, 99% coverage: 1:343/346 of query aligns to 7:345/346 of 2dfvA
- active site: C40 (= C38), G41 (= G39), T42 (≠ S40), H45 (= H43), H65 (= H60), E66 (= E61), C95 (= C90), C98 (= C93), C101 (= C96), C109 (= C104), K113 (≠ Q108), P151 (≠ A147), A155 (= A153), K340 (≠ A338)
- binding nicotinamide-adenine-dinucleotide: G175 (= G178), P176 (= P179), L177 (≠ I180), E197 (≠ D200), P198 (= P201), R202 (= R205), F241 (≠ A241), S242 (≠ V242), A244 (≠ G244), L264 (≠ I264), G265 (= G265), L266 (≠ V266), I289 (≠ V288), T290 (≠ G289)
- binding zinc ion: C95 (= C90), C101 (= C96), C109 (= C104)
O58389 L-threonine 3-dehydrogenase; L-ThrDH; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 2 papers)
30% identity, 99% coverage: 1:343/346 of query aligns to 9:347/348 of O58389
- C42 (= C38) binding
- T44 (≠ S40) mutation to A: Total loss of enzymatic activity.
- H67 (= H60) binding
- E68 (= E61) binding
- C97 (= C90) binding
- C100 (= C93) binding
- C103 (= C96) binding
- C111 (= C104) binding
- E152 (≠ Q146) mutation E->A,Q: Almost complete loss of enzymatic activity.; mutation to C: 120-fold decrease in catalytic efficiency.; mutation to D: Shows 3-fold higher turnover rate and reduced affinities toward L-threonine and NAD(+), compared to wild-type.; mutation to K: Total loss of enzymatic activity.
- L179 (≠ I180) binding
- E199 (≠ D200) binding ; mutation to A: Large decrease in affinity for NAD(+).
- R204 (= R205) binding ; mutation to A: Large decrease in affinity for NAD(+).
- LGL 266:268 (≠ IGV 264:266) binding
- IT 291:292 (≠ VG 288:289) binding
- R294 (≠ C291) mutation to A: 4000-fold decrease in catalytic efficiency.
7f3pD Crystal structure of a NADP-dependent alcohol dehydrogenase mutant in apo form (see paper)
31% identity, 99% coverage: 1:343/346 of query aligns to 4:352/355 of 7f3pD
2dphA Crystal structure of formaldehyde dismutase
29% identity, 99% coverage: 2:345/346 of query aligns to 4:391/398 of 2dphA
- active site: C45 (= C38), G46 (= G39), S47 (= S40), H50 (= H43), H66 (= H60), E67 (= E61), C96 (= C90), C99 (= C93), C102 (= C96), C110 (= C104), L114 (vs. gap), S168 (≠ T151), D169 (= D152), P172 (≠ A155), K386 (= K340)
- binding nicotinamide-adenine-dinucleotide: C45 (= C38), G46 (= G39), S47 (= S40), H50 (= H43), F92 (≠ A86), D169 (= D152), T173 (= T156), A192 (≠ I175), G193 (= G176), G195 (= G178), P196 (= P179), V197 (≠ I180), G216 (≠ I199), D217 (= D200), Q218 (≠ P201), R222 (= R205), L236 (= L217), V262 (= V242), H267 (vs. gap), P298 (≠ I264), G299 (= G265), I300 (≠ V266), A337 (≠ F301)
- binding zinc ion: C45 (= C38), H66 (= H60), C96 (= C90), C99 (= C93), C102 (= C96), C110 (= C104), D169 (= D152)
Q52078 Formaldehyde dismutase; EC 1.2.98.1 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see paper)
29% identity, 99% coverage: 2:345/346 of query aligns to 5:392/399 of Q52078
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2:399 modified: mature protein, Formaldehyde dismutase
3fpcA Chimera of alcohol dehydrogenase by exchange of the cofactor binding domain res 153-294 of t. Brockii adh by e. Histolytica adh (see paper)
30% identity, 99% coverage: 1:343/346 of query aligns to 1:349/352 of 3fpcA
- active site: C37 (= C38), T38 (≠ G39), S39 (= S40), H42 (= H43), H59 (= H60), E60 (= E61), D89 (≠ C90), T92 (≠ C93), V95 (≠ C96), S103 (≠ C104), D150 (= D152), T154 (= T156), K346 (= K340)
- binding zinc ion: C37 (= C38), H59 (= H60), D150 (= D152)
1h2bB Crystal structure of the alcohol dehydrogenase from the hyperthermophilic archaeon aeropyrum pernix at 1.65a resolution (see paper)
32% identity, 92% coverage: 1:319/346 of query aligns to 1:321/344 of 1h2bB
- active site: C39 (= C38), H40 (≠ G39), T41 (≠ S40), H44 (= H43), H64 (= H60), E65 (= E61), D94 (≠ C90), C97 (= C93), C100 (= C96), C108 (= C104), E112 (≠ Q108), D153 (= D152), T157 (= T156)
- binding nicotinamide-adenine-dinucleotide (acidic form): C39 (= C38), H40 (≠ G39), T41 (≠ S40), H44 (= H43), T157 (= T156), V180 (≠ L177), G181 (= G178), G182 (≠ P179), L183 (≠ I180), D203 (= D200), V204 (≠ P201), K208 (≠ R205), F246 (≠ A241), V247 (= V242), T252 (= T247), Y255 (≠ A250), V269 (≠ I264), G270 (= G265), Y271 (≠ V266), L293 (≠ T290), V294 (≠ C291)
- binding octanoic acid (caprylic acid): T41 (≠ S40), W50 (≠ G49), H64 (= H60), D153 (= D152), V294 (≠ C291)
- binding zinc ion: C39 (= C38), H64 (= H60), D94 (≠ C90), C97 (= C93), C100 (= C96), C108 (= C104), D153 (= D152)
Sites not aligning to the query:
Query Sequence
>CCNA_02929 FitnessBrowser__Caulo:CCNA_02929
MKALRYHGARDVRYESMDDPTPQSDRDAIVQVTACSICGSDLHIYHGHGFSEDLGFCVGH
EAVGEVVEVGRGVQRLKVGDKVMLPAAVGCGRCRSCLSGVIQTCENGQGACYGLSARLQG
SQAEAVRVPAADMNAVPVPDGVSMDQALMMTDALATAWFGARNAEVRPGASVAVIGLGPI
GLMAVESAYVMGAHVVYAIDPLPARRALAEEAGAIALHPDEALARVREDTKGRGLDCVIE
AVGGEATVDAALRLVRPRGVVSVIGVQQAKRFAFPLERAFGAGLTFRVGTCSVPEELPAL
FPLVRSGRLRPEKYISHRLPLSDGPEAYRLFESREAGALKMVLTPG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory