SitesBLAST
Comparing CCNA_02964 FitnessBrowser__Caulo:CCNA_02964 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4jnqA Crystal structure of a thioredoxin reductase from brucella melitensis
65% identity, 94% coverage: 3:316/335 of query aligns to 1:315/315 of 4jnqA
- active site: C137 (= C139), C140 (= C142), D141 (= D143)
- binding dihydroflavine-adenine dinucleotide: I12 (= I14), G13 (= G15), S14 (= S16), G15 (= G17), P16 (= P18), A17 (= A19), A36 (= A38), G37 (= G39), Q39 (= Q41), G42 (= G44), Q43 (= Q45), L44 (= L46), N52 (= N54), I85 (≠ V87), A113 (= A115), T114 (= T116), C140 (= C142), G283 (= G284), D284 (= D285), R291 (= R292), Q292 (= Q293), A293 (= A294)
5vt3B High resolution structure of thioredoxin-disulfide reductase from vibrio vulnificus cmcp6 in complex with NADP and fad
57% identity, 91% coverage: 7:312/335 of query aligns to 7:315/319 of 5vt3B
- active site: C138 (= C139), C141 (= C142), D142 (= D143)
- binding flavin-adenine dinucleotide: G15 (= G15), S16 (= S16), G17 (= G17), P18 (= P18), A19 (= A19), T38 (≠ A38), G39 (= G39), Q41 (= Q41), G44 (= G44), Q45 (= Q45), L46 (= L46), T49 (= T49), N54 (= N54), H86 (≠ I86), I87 (≠ V87), S114 (≠ A115), T115 (= T116), G116 (= G117), E162 (= E163), H247 (= H247), G287 (= G284), D288 (= D285), R295 (= R292), Q296 (= Q293), A297 (= A294), S300 (≠ A297)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L122 (= L123), G156 (= G157), G157 (= G158), N158 (= N159), T159 (= T160), H178 (= H179), R179 (= R180), R180 (≠ K181), R184 (= R185), I245 (= I245), G246 (= G246), R295 (= R292), Q296 (= Q293)
5u63B Crystal structure of putative thioredoxin reductase from haemophilus influenzae
57% identity, 91% coverage: 7:312/335 of query aligns to 8:316/319 of 5u63B
- active site: C139 (= C139), C142 (= C142), D143 (= D143)
- binding flavin-adenine dinucleotide: G16 (= G15), S17 (= S16), G18 (= G17), P19 (= P18), A20 (= A19), T39 (≠ A38), G40 (= G39), Q42 (= Q41), G45 (= G44), Q46 (= Q45), L47 (= L46), T50 (= T49), N55 (= N54), H87 (≠ I86), I88 (≠ V87), A115 (= A115), T116 (= T116), G117 (= G117), H248 (= H247), G288 (= G284), D289 (= D285), R296 (= R292), Q297 (= Q293), A298 (= A294), S301 (≠ A297)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R121 (≠ K121), G157 (= G157), H179 (= H179), R180 (= R180), R181 (≠ K181), I246 (= I245), G247 (= G246), H248 (= H247), R296 (= R292)
P0A9P4 Thioredoxin reductase; TRXR; EC 1.8.1.9 from Escherichia coli (strain K12) (see 2 papers)
53% identity, 92% coverage: 5:312/335 of query aligns to 3:314/321 of P0A9P4
- 36:43 (vs. 38:45, 50% identical) binding
- C136 (= C139) modified: Disulfide link with 139, Redox-active
- C139 (= C142) modified: Disulfide link with 136, Redox-active
- 287:296 (vs. 285:294, 70% identical) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1f6mA Crystal structure of a complex between thioredoxin reductase, thioredoxin, and the NADP+ analog, aadp+ (see paper)
52% identity, 92% coverage: 5:312/335 of query aligns to 2:313/320 of 1f6mA
- active site: S135 (≠ C139), C138 (= C142), D139 (= D143)
- binding 3-aminopyridine-adenine dinucleotide phosphate: L119 (= L123), G153 (= G157), G154 (= G158), N155 (= N159), T156 (= T160), E159 (= E163), H175 (= H179), R176 (= R180), R177 (≠ K181), R181 (= R185), I243 (= I245), G244 (= G246), H245 (= H247), R293 (= R292), Q294 (= Q293)
- binding flavin-adenine dinucleotide: G12 (= G15), S13 (= S16), G14 (= G17), P15 (= P18), A16 (= A19), T35 (≠ A38), G36 (= G39), E38 (≠ Q41), G41 (= G44), Q42 (= Q45), L43 (= L46), T46 (= T49), V49 (= V52), N51 (= N54), H83 (≠ I86), I84 (≠ V87), A111 (= A115), T112 (= T116), G113 (= G117), H245 (= H247), G285 (= G284), D286 (= D285), R293 (= R292), Q294 (= Q293), A295 (= A294), S298 (≠ A297)
1tdfA Crystal structure of escherichia coli thioredoxin reductase refined at 2 angstrom resolution: implications for a large conformational change during catalysis (see paper)
52% identity, 92% coverage: 5:312/335 of query aligns to 2:313/316 of 1tdfA
- active site: C135 (= C139), S138 (≠ C142), D139 (= D143)
- binding flavin-adenine dinucleotide: G12 (= G15), S13 (= S16), G14 (= G17), P15 (= P18), A16 (= A19), T35 (≠ A38), G36 (= G39), E38 (≠ Q41), G41 (= G44), Q42 (= Q45), L43 (= L46), T46 (= T49), V49 (= V52), N51 (= N54), H83 (≠ I86), I84 (≠ V87), A111 (= A115), T112 (= T116), S138 (≠ C142), G285 (= G284), D286 (= D285), R293 (= R292), Q294 (= Q293), A295 (= A294), S298 (≠ A297)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L119 (= L123), I151 (≠ V155), T156 (= T160), E159 (= E163), H175 (= H179), R176 (= R180), R181 (= R185), E183 (= E187), I243 (= I245), G244 (= G246), H290 (≠ D289), R293 (= R292)
6bpyA Aspergillus fumigatus thioredoxin reductase (see paper)
50% identity, 92% coverage: 8:314/335 of query aligns to 2:321/324 of 6bpyA
- binding flavin-adenine dinucleotide: I8 (= I14), G9 (= G15), S10 (= S16), G11 (= G17), P12 (= P18), A13 (= A19), Y31 (vs. gap), E32 (vs. gap), G33 (vs. gap), A36 (= A38), T38 (≠ I40), A39 (≠ Q41), G42 (= G44), Q43 (= Q45), L44 (= L46), T47 (= T49), I50 (≠ V52), N52 (= N54), T84 (≠ I86), I85 (≠ V87), T120 (= T116), G121 (= G117), C146 (= C142), G291 (= G284), D292 (= D285), R299 (= R292), Q300 (= Q293), A301 (= A294), S304 (≠ A297)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G163 (= G157), G164 (= G158), S166 (≠ T160), R186 (= R180), R187 (≠ K181), R191 (= R185), V252 (≠ I245)
5uthA Crystal structure of thioredoxin reductase from mycobacterium smegmatis in complex with fad
52% identity, 91% coverage: 12:315/335 of query aligns to 7:306/306 of 5uthA
- active site: C133 (= C139), C136 (= C142), D137 (= D143)
- binding flavin-adenine dinucleotide: I9 (= I14), G10 (= G15), S11 (= S16), G12 (= G17), P13 (= P18), A14 (= A19), F32 (≠ I37), E33 (≠ A38), G34 (= G39), Q36 (= Q41), G39 (= G44), A40 (≠ Q45), L41 (= L46), N49 (= N54), D81 (≠ I86), V82 (= V87), M110 (≠ T116), G111 (= G117), C136 (= C142), G275 (= G284), D276 (= D285), R283 (= R292), Q284 (= Q293), A285 (= A294), A288 (= A297)
8ccmA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with compound 2-06
52% identity, 91% coverage: 12:315/335 of query aligns to 6:305/305 of 8ccmA
- binding flavin-adenine dinucleotide: I8 (= I14), G9 (= G15), S10 (= S16), G11 (= G17), P12 (= P18), A13 (= A19), E32 (≠ A38), G33 (= G39), Q35 (= Q41), G38 (= G44), A39 (≠ Q45), L40 (= L46), T43 (= T49), N48 (= N54), D80 (≠ I86), V81 (= V87), M109 (≠ T116), G110 (= G117), T131 (≠ A138), C135 (= C142), G274 (= G284), D275 (= D285), R282 (= R292), Q283 (= Q293), A284 (= A294), A287 (= A297)
- binding ~{N}6-(4-aminophenyl)-1,2-benzothiazole-3,6-diamine: R114 (≠ K121), H115 (≠ W122), L116 (= L123), R173 (= R180), E200 (≠ V207), I201 (= I208), I235 (= I245)
8cclA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry a09
52% identity, 91% coverage: 12:315/335 of query aligns to 6:305/305 of 8cclA
- binding flavin-adenine dinucleotide: I8 (= I14), G9 (= G15), S10 (= S16), G11 (= G17), P12 (= P18), A13 (= A19), E32 (≠ A38), G33 (= G39), Q35 (= Q41), G38 (= G44), A39 (≠ Q45), L40 (= L46), T43 (= T49), N48 (= N54), D80 (≠ I86), V81 (= V87), M109 (≠ T116), G110 (= G117), T131 (≠ A138), C135 (= C142), G274 (= G284), D275 (= D285), R282 (= R292), Q283 (= Q293), A284 (= A294), A287 (= A297)
- binding [1,2]thiazolo[5,4-b]pyridin-3-amine: L116 (= L123), R173 (= R180), E200 (≠ V207), I201 (= I208)
8cckA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry h07
52% identity, 91% coverage: 12:315/335 of query aligns to 6:305/305 of 8cckA
- binding flavin-adenine dinucleotide: G9 (= G15), S10 (= S16), G11 (= G17), P12 (= P18), A13 (= A19), E32 (≠ A38), G33 (= G39), Q35 (= Q41), G38 (= G44), A39 (≠ Q45), L40 (= L46), T43 (= T49), N48 (= N54), D80 (≠ I86), V81 (= V87), M109 (≠ T116), G110 (= G117), T131 (≠ A138), C135 (= C142), G274 (= G284), D275 (= D285), R282 (= R292), Q283 (= Q293), A284 (= A294), A287 (= A297)
- binding ~{N}-(4-hydroxyphenyl)-2-pyrazol-1-yl-ethanamide: R114 (≠ K121), H115 (≠ W122), L116 (= L123), V148 (= V155), R173 (= R180), E200 (≠ V207), I201 (= I208)
8ccjA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with NADPH
52% identity, 91% coverage: 12:315/335 of query aligns to 6:305/305 of 8ccjA
- binding flavin-adenine dinucleotide: I8 (= I14), G9 (= G15), S10 (= S16), G11 (= G17), P12 (= P18), A13 (= A19), E32 (≠ A38), G33 (= G39), Q35 (= Q41), G38 (= G44), A39 (≠ Q45), L40 (= L46), T43 (= T49), N48 (= N54), D80 (≠ I86), V81 (= V87), M109 (≠ T116), G110 (= G117), T131 (≠ A138), C135 (= C142), G274 (= G284), D275 (= D285), R282 (= R292), Q283 (= Q293), A284 (= A294), A287 (= A297)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G150 (= G157), G151 (= G158), D152 (≠ N159), S153 (≠ T160), E156 (= E163), H172 (= H179), R173 (= R180), R174 (≠ K181), R178 (= R185), I235 (= I245)
5w4cA Crystal structure of thioredoxin reductase from cryptococcus neoformans in complex with fad (fo conformation)
49% identity, 92% coverage: 8:316/335 of query aligns to 17:334/356 of 5w4cA
- binding calcium ion: E99 (≠ D85), E116 (≠ D102), E118 (≠ G104)
- binding flavin-adenine dinucleotide: I23 (= I14), G24 (= G15), S25 (= S16), P27 (= P18), G28 (≠ A19), Y46 (≠ I37), G48 (= G39), A51 (vs. gap), F54 (vs. gap), G58 (= G44), Q59 (= Q45), L60 (= L46), T63 (= T49), N68 (= N54), V101 (= V87), T134 (= T116), G135 (= G117), G302 (= G284), D303 (= D285), R310 (= R292), Q311 (= Q293), A312 (= A294), S315 (≠ A297)
Sites not aligning to the query:
Q39243 Thioredoxin reductase 1, mitochondrial; NADPH-dependent thioredoxin reductase 1; NTR1; NADPH-dependent thioredoxin reductase B; AtNTRB; EC 1.8.1.9 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
50% identity, 94% coverage: 1:314/335 of query aligns to 43:366/375 of Q39243
- SGPA 58:61 (= SGPA 16:19) binding
- FE 79:80 (≠ IA 37:38) binding
- IAPGGQ 87:92 (≠ IQPGGQ 40:45) binding
- N101 (= N54) binding
- V134 (= V87) binding
- C189 (= C139) modified: Disulfide link with 192, Redox-active
- C192 (= C142) binding ; modified: Disulfide link with 189, Redox-active
- D337 (= D285) binding
- RQA 344:346 (= RQA 292:294) binding
Sites not aligning to the query:
- 1:37 modified: transit peptide, Mitochondrion
2whdB Barley NADPH-dependent thioredoxin reductase 2 (see paper)
50% identity, 93% coverage: 5:314/335 of query aligns to 3:318/319 of 2whdB
- active site: C141 (= C139), C144 (= C142), D145 (= D143)
- binding flavin-adenine dinucleotide: G13 (= G15), S14 (= S16), G15 (= G17), P16 (= P18), A17 (= A19), G37 (= G39), A40 (vs. gap), G47 (= G44), Q48 (= Q45), L49 (= L46), T52 (= T49), N57 (= N54), T89 (≠ I86), V90 (= V87), T118 (= T116), G119 (= G117), C144 (= C142), G288 (= G284), D289 (= D285), R296 (= R292), Q297 (= Q293), A298 (= A294)
Q92375 Thioredoxin reductase; Caffeine resistance protein 4; EC 1.8.1.9 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
48% identity, 92% coverage: 8:314/335 of query aligns to 3:317/322 of Q92375
- S192 (≠ E187) modified: Phosphoserine
- T278 (= T275) modified: Phosphothreonine
- S279 (≠ A276) modified: Phosphoserine
4ccqA Crystal structure of the thioredoxin reductase from entamoeba histolytica with NADP (see paper)
48% identity, 90% coverage: 12:312/335 of query aligns to 7:310/313 of 4ccqA
- active site: C139 (= C139), C142 (= C142), D143 (= D143), D161 (≠ N159), E165 (= E163)
- binding flavin-adenine dinucleotide: I9 (= I14), G10 (= G15), S11 (= S16), G12 (= G17), P13 (= P18), A14 (= A19), Y32 (≠ I37), E33 (vs. gap), G34 (vs. gap), A37 (vs. gap), V40 (≠ I40), A41 (≠ Q41), G44 (= G44), Q45 (= Q45), L46 (= L46), T49 (= T49), N54 (= N54), T86 (≠ I86), I87 (≠ V87), T116 (= T116), G117 (= G117), H247 (= H247), G282 (= G284), D283 (= D285), R290 (= R292), Q291 (= Q293), A292 (= A294), A295 (= A297)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G159 (= G157), G160 (= G158), D161 (≠ N159), A162 (≠ T160), E165 (= E163), H181 (= H179), R182 (= R180), R183 (≠ K181), R187 (= R185), I245 (= I245)
4a5lA Crystal structure of the thioredoxin reductase from entamoeba histolytica (see paper)
48% identity, 90% coverage: 12:312/335 of query aligns to 7:310/313 of 4a5lA
- active site: C139 (= C139), C142 (= C142), D143 (= D143), D161 (≠ N159), E165 (= E163)
- binding flavin-adenine dinucleotide: I9 (= I14), G10 (= G15), S11 (= S16), G12 (= G17), P13 (= P18), A14 (= A19), Y32 (≠ I37), E33 (vs. gap), G34 (vs. gap), A37 (vs. gap), V40 (≠ I40), A41 (≠ Q41), G44 (= G44), Q45 (= Q45), L46 (= L46), T49 (= T49), I52 (≠ V52), N54 (= N54), T86 (≠ I86), I87 (≠ V87), T116 (= T116), G117 (= G117), H247 (= H247), G282 (= G284), D283 (= D285), R290 (= R292), Q291 (= Q293), A292 (= A294), A295 (= A297)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G159 (= G157), A162 (≠ T160), H181 (= H179), R182 (= R180), R183 (≠ K181), R187 (= R185), I245 (= I245)
Q70G58 Thioredoxin reductase NTRC; NADPH-dependent thioredoxin reductase C; OsNTRC; EC 1.8.1.9 from Oryza sativa subsp. japonica (Rice) (see 2 papers)
48% identity, 96% coverage: 12:332/335 of query aligns to 73:398/515 of Q70G58
- C203 (= C139) mutation to S: Loss of thioredoxin reductase activity.
- C206 (= C142) mutation to S: Loss of thioredoxin reductase activity.
- A227 (= A161) mutation to G: Reduces activity 30-fold; when associated with E-245 and F-246.
- V245 (≠ H179) mutation to E: Reduces activity 30-fold; when associated with G-227 and F-246.
- R246 (= R180) mutation to F: Reduces activity 30-fold; when associated with G-227 and E-245.
Sites not aligning to the query:
- 440 C→S: Loss of thioredoxin activity.
- 443 C→S: Loss of thioredoxin activity.
4a65A Crystal structure of the thioredoxin reductase from entamoeba histolytica with aucn (see paper)
48% identity, 90% coverage: 12:312/335 of query aligns to 5:308/311 of 4a65A
- active site: C137 (= C139), C140 (= C142), D141 (= D143), D159 (≠ N159), E163 (= E163)
- binding gold ion: G280 (= G284), C283 (≠ T287)
- binding flavin-adenine dinucleotide: I7 (= I14), G8 (= G15), S9 (= S16), G10 (= G17), P11 (= P18), A12 (= A19), Y30 (≠ I37), E31 (vs. gap), G32 (vs. gap), A35 (vs. gap), V38 (≠ I40), A39 (≠ Q41), G42 (= G44), Q43 (= Q45), N52 (= N54), T84 (≠ I86), I85 (≠ V87), T114 (= T116), G115 (= G117), H245 (= H247), G280 (= G284), D281 (= D285), R288 (= R292), Q289 (= Q293), A290 (= A294), A293 (= A297)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G157 (= G157), G158 (= G158), A160 (≠ T160), H179 (= H179), R180 (= R180), R181 (≠ K181), R185 (= R185), I243 (= I245)
Query Sequence
>CCNA_02964 FitnessBrowser__Caulo:CCNA_02964
MSTLSPRQTRCLIIGSGPAGYTAAIYAARALLKPVLIAGIQPGGQLTITTDVENYPGFAD
VIQGPWLMDQMRAQAEHVGTEFVSDIVTSVDLSKRPFTVKTDSGQDWIAETIIIATGAQA
KWLGLESEAKFQGFGVSACATCDGFFYRNKDVIVVGGGNTAVEEALFLTSFASKVTLVHR
KDELRAEKILQERLLAHPKIEVIWDSVIDEVLGQTDPMGVTGARLKNVKTGETQEVAADG
VFIAIGHAPSSELFAGQLETGSGGYLKVKPGTASTAIEGVYAAGDVTDDVYRQAVTAAGM
GCMAALEAVRFLAEEDHKAAHHPISHAEANKIGVW
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory