SitesBLAST
Comparing CCNA_03047 FitnessBrowser__Caulo:CCNA_03047 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1i2lA Deoxychorismate lyase from escherichia coli with inhibitor
31% identity, 97% coverage: 3:245/251 of query aligns to 8:261/269 of 1i2lA
- active site: F26 (= F21), T28 (= T23), I139 (≠ L128), K140 (= K129), E173 (≠ C162), V197 (≠ L186)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: R45 (= R40), K140 (= K129), E173 (≠ C162), C175 (≠ A164), A176 (= A165), A177 (= A166), N178 (= N167), V197 (≠ L186), G199 (= G188), I200 (≠ T189), M201 (≠ T190), N236 (= N220), A237 (≠ S221)
1i2kA Aminodeoxychorismate lyase from escherichia coli
31% identity, 97% coverage: 3:245/251 of query aligns to 8:261/269 of 1i2kA
- active site: F26 (= F21), T28 (= T23), I139 (≠ L128), K140 (= K129), E173 (≠ C162), V197 (≠ L186)
- binding pyridoxal-5'-phosphate: R45 (= R40), K140 (= K129), E173 (≠ C162), A176 (= A165), A177 (= A166), V197 (≠ L186), G199 (= G188), I200 (≠ T189), M201 (≠ T190), N236 (= N220), A237 (≠ S221)
2y4rA Crystal structure of 4-amino-4-deoxychorismate lyase from pseudomonas aeruginosa (see paper)
35% identity, 98% coverage: 3:249/251 of query aligns to 7:264/270 of 2y4rA
- active site: F26 (= F21), T28 (= T23), K139 (= K129), E172 (≠ C162), V196 (= V185)
- binding pyridoxal-5'-phosphate: R45 (= R40), K139 (= K129), S176 (≠ A166), V196 (= V185), G198 (= G188), V199 (≠ T189), N235 (= N220), S236 (= S221)
5e25A Crystal structure of branched-chain aminotransferase from thermophilic archaea geoglobus acetivorans complexed with alpha-ketoglutarate (see paper)
29% identity, 92% coverage: 7:236/251 of query aligns to 19:262/290 of 5e25A
- active site: F33 (= F21), G35 (≠ T23), K151 (= K129), E184 (≠ C162), L207 (= L186)
- binding 2-oxoglutaric acid: Y88 (≠ A72), K151 (= K129), T247 (≠ S221), A248 (≠ L222)
- binding pyridoxal-5'-phosphate: R52 (= R40), K151 (= K129), Y155 (= Y133), E184 (≠ C162), G187 (≠ A165), D188 (≠ A166), L207 (= L186), G209 (= G188), I210 (≠ T189), T211 (= T190), G246 (≠ N220), T247 (≠ S221)
5mr0D Thermophilic archaeal branched-chain amino acid transaminases from geoglobus acetivorans and archaeoglobus fulgidus: biochemical and structural characterisation (see paper)
28% identity, 92% coverage: 6:236/251 of query aligns to 17:261/290 of 5mr0D
- active site: F32 (= F21), G34 (≠ T23), K150 (= K129), E183 (≠ C162), L206 (= L186)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: R51 (= R40), G100 (= G85), L101 (= L86), K150 (= K129), Y154 (= Y133), E183 (≠ C162), G186 (≠ A165), D187 (≠ A166), L206 (= L186), I209 (≠ T189), T210 (= T190), G245 (≠ N220), T246 (≠ S221)
7p3tB Transaminase of gamma-proteobacterium (see paper)
33% identity, 76% coverage: 5:195/251 of query aligns to 11:217/299 of 7p3tB
- binding pyridoxal-5'-phosphate: R53 (= R40), K153 (= K129), R157 (≠ Y133), E186 (≠ C162), S187 (≠ A163), A188 (= A164), A189 (= A165), S190 (≠ A166), G210 (= G188), I211 (≠ T189), T212 (= T190)
Sites not aligning to the query:
8pnyA Crystal structure of d-amino acid aminotransferase from blastococcus saxobsidens complexed with phenylhydrazine and in its apo form (see paper)
35% identity, 86% coverage: 11:226/251 of query aligns to 26:251/278 of 8pnyA
- binding [6-methyl-5-oxidanyl-4-[(2-phenylhydrazinyl)methyl]pyridin-3-yl]methyl dihydrogen phosphate: F36 (= F21), S38 (≠ T23), R55 (= R40), K152 (= K129), Y156 (= Y133), E185 (≠ C162), G186 (≠ A163), P187 (≠ A164), T188 (≠ A165), S189 (≠ A166), T190 (≠ N167), L209 (= L186), T212 (= T189), T213 (= T190), S248 (≠ I223), G249 (= G224)
8pnwA Crystal structure of d-amino acid aminotransferase from blastococcus saxobsidens in holo form with plp (see paper)
35% identity, 86% coverage: 11:226/251 of query aligns to 26:251/278 of 8pnwA
- binding pyridoxal-5'-phosphate: R55 (= R40), K152 (= K129), Y156 (= Y133), E185 (≠ C162), P187 (≠ A164), T188 (≠ A165), S189 (≠ A166), L209 (= L186), T212 (= T189), T213 (= T190), G249 (= G224)
5k3wA Structural characterisation of fold iv-transaminase, cputa1, from curtobacterium pusillum (see paper)
30% identity, 98% coverage: 7:251/251 of query aligns to 32:288/298 of 5k3wA
- binding pyridoxal-5'-phosphate: R65 (= R40), K164 (= K129), Y168 (= Y133), E197 (≠ C162), P199 (≠ A164), T200 (≠ A165), S201 (≠ A166), N202 (= N167), L221 (= L186), T224 (= T189), T225 (= T190), S261 (= S221)
6fteB Crystal structure of an (r)-selective amine transaminase from exophiala xenobiotica
28% identity, 75% coverage: 7:194/251 of query aligns to 44:242/321 of 6fteB
- active site: Y58 (≠ F21), K179 (= K129), E212 (≠ C162), L234 (= L186)
- binding pyridoxal-5'-phosphate: R77 (= R40), K179 (= K129), E212 (≠ C162), F216 (≠ A166), N217 (= N167), L234 (= L186), G236 (= G188), V237 (≠ T189), T238 (= T190)
Sites not aligning to the query:
7z79B Crystal structure of aminotransferase-like protein from variovorax paradoxus
30% identity, 96% coverage: 7:247/251 of query aligns to 32:289/306 of 7z79B
- binding pyridoxal-5'-phosphate: W46 (≠ F21), R65 (= R40), N166 (≠ K129), S202 (≠ A165), T203 (≠ A166), F222 (≠ L186), G224 (= G188), I225 (≠ T189), T226 (= T190), G261 (≠ N220), T262 (≠ S221)
6xwbA Crystal structure of an r-selective transaminase from thermomyces stellatus. (see paper)
28% identity, 90% coverage: 7:231/251 of query aligns to 44:283/319 of 6xwbA
- binding pyridoxal-5'-phosphate: R77 (= R40), K178 (= K129), F185 (≠ N136), E211 (≠ C162), G214 (≠ A165), F215 (≠ A166), N216 (= N167), L233 (= L186), G235 (= G188), V236 (≠ T189), T237 (= T190), T273 (≠ S221)
4cmfA The (r)-selective transaminase from nectria haematococca with inhibitor bound (see paper)
28% identity, 92% coverage: 7:238/251 of query aligns to 44:291/322 of 4cmfA
- active site: Y58 (≠ F21), V60 (≠ T23), K179 (= K129), E212 (≠ C162), L234 (= L186)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: V60 (≠ T23), R77 (= R40), F113 (vs. gap), K179 (= K129), E212 (≠ C162), G215 (≠ A165), F216 (≠ A166), N217 (= N167), L234 (= L186), G236 (= G188), I237 (≠ T189), T238 (= T190), T273 (≠ N220), T274 (≠ S221), A275 (≠ L222)
4cmdA The (r)-selective transaminase from nectria haematococca (see paper)
28% identity, 92% coverage: 7:238/251 of query aligns to 44:291/322 of 4cmdA
- active site: Y58 (≠ F21), V60 (≠ T23), K179 (= K129), E212 (≠ C162), L234 (= L186)
- binding pyridoxal-5'-phosphate: R77 (= R40), K179 (= K129), E212 (≠ C162), G215 (≠ A165), F216 (≠ A166), L234 (= L186), G236 (= G188), I237 (≠ T189), T238 (= T190), T274 (≠ S221)
3cswC Crystal structure of a putative branched-chain amino acid aminotransferase (tm0831) from thermotoga maritima at 2.15 a resolution
34% identity, 49% coverage: 128:250/251 of query aligns to 134:262/275 of 3cswC
- active site: K135 (= K129), E166 (≠ C162), L190 (= L186)
- binding pyridoxal-5'-phosphate: K135 (= K129), E166 (≠ C162), F169 (≠ A165), S170 (≠ A166), L190 (= L186), G192 (= G188), I193 (≠ T189), T194 (= T190), T230 (≠ S221)
Sites not aligning to the query:
6thqB Crystal structure of branched-chain aminotransferase from thermophilic archaea thermoproteus uzoniensis with norvaline
29% identity, 53% coverage: 114:245/251 of query aligns to 140:278/301 of 6thqB
- active site: K156 (≠ L128), E190 (≠ C162), L214 (= L186)
- binding pyridoxal-5'-phosphate: K156 (≠ L128), Y161 (= Y133), E190 (≠ C162), N195 (= N167), L214 (= L186), G216 (= G188), I217 (≠ T189), T218 (= T190), T254 (≠ S221)
- binding 2-[o-phosphonopyridoxyl]-amino-pentanoic acid: K156 (≠ L128), Y161 (= Y133), E190 (≠ C162), G193 (≠ A165), E194 (≠ A166), N195 (= N167), G216 (= G188), I217 (≠ T189), T218 (= T190), G253 (≠ N220), T254 (≠ S221), A255 (≠ L222)
Sites not aligning to the query:
4ce5B First crystal structure of an (r)-selective omega-transaminase from aspergillus terreus (see paper)
29% identity, 90% coverage: 7:231/251 of query aligns to 46:285/325 of 4ce5B
- active site: Y60 (≠ F21), K180 (= K129), E213 (≠ C162), L235 (= L186)
- binding calcium ion: D67 (= D28), R69 (≠ A30)
- binding n-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-d-glutamic acid: V62 (≠ T23), R79 (= R40), K180 (= K129), W184 (≠ Y133), E213 (≠ C162), G216 (≠ A165), F217 (≠ A166), N218 (= N167), L235 (= L186), G237 (= G188), V238 (≠ T189), T239 (= T190), T274 (≠ N220), T275 (≠ S221), A276 (≠ L222)
- binding pyridoxal-5'-phosphate: R79 (= R40), K180 (= K129), E213 (≠ C162), G216 (≠ A165), F217 (≠ A166), L235 (= L186), G237 (= G188), V238 (≠ T189), T239 (= T190), T275 (≠ S221)
4ce5A First crystal structure of an (r)-selective omega-transaminase from aspergillus terreus (see paper)
29% identity, 90% coverage: 7:231/251 of query aligns to 46:285/325 of 4ce5A
- active site: Y60 (≠ F21), K180 (= K129), E213 (≠ C162), L235 (= L186)
- binding n-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-d-glutamic acid: Y60 (≠ F21), V62 (≠ T23), R79 (= R40), K180 (= K129), W184 (≠ Y133), E213 (≠ C162), G216 (≠ A165), F217 (≠ A166), N218 (= N167), L235 (= L186), G237 (= G188), V238 (≠ T189), T239 (= T190), T274 (≠ N220), T275 (≠ S221)
- binding pyridoxal-5'-phosphate: R79 (= R40), K180 (= K129), E213 (≠ C162), F217 (≠ A166), L235 (= L186), G237 (= G188), V238 (≠ T189), T239 (= T190), T275 (≠ S221)
P19938 D-alanine aminotransferase; D-amino acid aminotransferase; D-amino acid transaminase; DAAT; D-aspartate aminotransferase; EC 2.6.1.21 from Bacillus sp. (strain YM-1) (see 5 papers)
24% identity, 74% coverage: 11:196/251 of query aligns to 22:212/283 of P19938
- Y32 (≠ F21) binding
- R51 (= R40) binding
- R99 (= R84) binding
- H101 (≠ L86) binding
- K146 (= K129) active site, Proton acceptor; modified: N6-(pyridoxal phosphate)lysine
- E178 (≠ C162) binding ; mutation to K: Loss of transaminase activity and small gain in racemase activity.
- L202 (= L186) mutation to A: Inactivates enzyme.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3lqsA Complex structure of d-amino acid aminotransferase and 4-amino-4,5- dihydro-thiophenecarboxylic acid (adta) (see paper)
24% identity, 74% coverage: 11:196/251 of query aligns to 21:211/280 of 3lqsA
- active site: Y31 (≠ F21), V33 (≠ T23), K145 (= K129), E177 (≠ C162), L201 (= L186)
- binding 4-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]thiophene-2-carboxylic acid: V33 (≠ T23), R50 (= R40), E177 (≠ C162), S180 (≠ A165), S181 (≠ A166), N182 (= N167), L201 (= L186), G203 (= G188), I204 (≠ T189), T205 (= T190)
Sites not aligning to the query:
Query Sequence
>CCNA_03047 FitnessBrowser__Caulo:CCNA_03047
MTRPDAVPLNDRGLLLGDGLFETMLAQDGAVAHLPAHLDRMAAGCAVLGLPFDREAAQRL
VLAAAPSQGRFAIRLTLTAGSGGRGLDRPEAPAVRLFATAAPSTPVTTPATLIVAATRRN
EGSPASRLKTLAYLDNVLARAEARAAGADDALMLNNRGEIACAAAANLFWLAGGRLFTPR
LDCGVLAGTTRARLLAREAVEEVAVGVEALEAAEAVVLTNSLIGVRPVSRLGERALPEHP
LAARLNARLDA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory