SitesBLAST
Comparing CCNA_03061 CCNA_03061 SDR family dehydrogenase, group 9 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4yacA Crystal structure of ligo in complex with nadh from sphingobium sp. Strain syk-6 (see paper)
36% identity, 65% coverage: 16:192/273 of query aligns to 7:187/270 of 4yacA
- active site: S144 (= S149), Y157 (= Y162), K161 (= K166)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G13 (= G22), S16 (= S25), G17 (= G26), D38 (= D46), I39 (= I47), H43 (≠ G51), L63 (= L69), D64 (= D70), L65 (≠ V71)
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
38% identity, 68% coverage: 16:200/273 of query aligns to 8:194/261 of 6zzsD
- active site: G18 (= G26), S143 (= S149), Y156 (= Y162)
- binding nicotinamide-adenine-dinucleotide: G14 (= G22), S17 (= S25), I19 (= I27), D38 (= D46), M39 (≠ I47), D64 (= D70), V65 (= V71), N91 (= N98), A92 (= A99), G93 (= G100), M141 (≠ V147), A142 (= A148), S143 (= S149), Y156 (= Y162), K160 (= K166), P186 (= P192), G187 (≠ W193), V189 (= V195), T191 (= T197), L193 (≠ I199)
- binding 3-oxidanylidenepentanoic acid: Q95 (≠ A102), S143 (= S149), N145 (≠ A151), K153 (≠ L159), Y156 (= Y162)
Sites not aligning to the query:
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
38% identity, 68% coverage: 16:200/273 of query aligns to 7:193/260 of 6zzqA
- active site: G17 (= G26), S142 (= S149), Y155 (= Y162)
- binding acetoacetic acid: Q94 (≠ A102), S142 (= S149), K152 (≠ L159), Y155 (= Y162)
- binding nicotinamide-adenine-dinucleotide: G13 (= G22), S16 (= S25), G17 (= G26), I18 (= I27), D37 (= D46), M38 (≠ I47), D63 (= D70), V64 (= V71), N90 (= N98), A91 (= A99), G92 (= G100), M140 (≠ V147), A141 (= A148), S142 (= S149), Y155 (= Y162), K159 (= K166), Y187 (≠ F194), V188 (= V195), T190 (= T197)
Sites not aligning to the query:
Q48436 Diacetyl reductase [(S)-acetoin forming]; Acetoin(diacetyl) reductase; AR; Meso-2,3-butanediol dehydrogenase; EC 1.1.1.304 from Klebsiella pneumoniae (see paper)
37% identity, 68% coverage: 15:199/273 of query aligns to 2:189/256 of Q48436
- 6:33 (vs. 19:46, 43% identical) binding
- D59 (= D70) binding
- K156 (= K166) binding
1gegE Cryatal structure analysis of meso-2,3-butanediol dehydrogenase (see paper)
37% identity, 68% coverage: 15:199/273 of query aligns to 2:189/256 of 1gegE
- active site: G13 (= G26), S139 (= S149), Y152 (= Y162), K156 (= K166)
- binding alpha-D-glucopyranose: R63 (= R74), D64 (≠ E75), F67 (≠ E78), E123 (≠ P135)
- binding nicotinamide-adenine-dinucleotide: G9 (= G22), Q12 (≠ S25), I14 (= I27), D33 (= D46), Y34 (≠ I47), V58 (≠ L69), D59 (= D70), V60 (= V71), N86 (= N98), A87 (= A99), I109 (= I121), S139 (= S149), Y152 (= Y162), K156 (= K166), P182 (= P192), V185 (= V195), T187 (= T197), M189 (≠ I199)
Sites not aligning to the query:
4nbuB Crystal structure of fabg from bacillus sp (see paper)
35% identity, 75% coverage: 16:220/273 of query aligns to 8:210/244 of 4nbuB
- active site: G18 (= G26), N111 (= N122), S139 (= S149), Q149 (≠ L159), Y152 (= Y162), K156 (= K166)
- binding acetoacetyl-coenzyme a: D93 (≠ F104), K98 (≠ E109), S139 (= S149), N146 (≠ S156), V147 (≠ P157), Q149 (≠ L159), Y152 (= Y162), F184 (= F194), M189 (≠ I199), K200 (≠ S210)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G22), N17 (≠ S25), G18 (= G26), I19 (= I27), D38 (= D46), F39 (≠ I47), V59 (≠ L69), D60 (= D70), V61 (= V71), N87 (= N98), A88 (= A99), G89 (= G100), I90 (≠ V101), T137 (≠ V147), S139 (= S149), Y152 (= Y162), K156 (= K166), P182 (= P192), F184 (= F194), T185 (≠ V195), T187 (= T197), M189 (≠ I199)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
30% identity, 77% coverage: 16:225/273 of query aligns to 8:217/255 of 5itvA
- active site: G18 (= G26), S141 (= S149), Y154 (= Y162), K158 (= K166)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G22), S17 (= S25), G18 (= G26), I19 (= I27), D38 (= D46), I39 (= I47), T61 (≠ L69), I63 (≠ V71), N89 (= N98), G91 (= G100), T139 (≠ V147), S141 (= S149), Y154 (= Y162), K158 (= K166), P184 (= P192), G185 (≠ W193), I186 (≠ F194), I187 (≠ V195)
6t62A Crystal structure of acinetobacter baumannii fabg in complex with NADPH at 1.8 a resolution (see paper)
32% identity, 75% coverage: 12:215/273 of query aligns to 2:204/244 of 6t62A
- active site: G16 (= G26), S138 (= S149), Y151 (= Y162)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G22), S14 (≠ A24), R15 (≠ S25), A36 (≠ D46), T37 (≠ I47), L58 (= L69), D59 (= D70), V60 (= V71), N86 (= N98), A87 (= A99), G88 (= G100), I89 (≠ V101), I136 (≠ V147), S137 (≠ A148), S138 (= S149), Y151 (= Y162), K155 (= K166), P181 (= P192), G182 (≠ W193), I184 (≠ V195), M188 (≠ I199)
1zk1A Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and NAD (see paper)
34% identity, 74% coverage: 16:217/273 of query aligns to 7:211/251 of 1zk1A
- active site: G17 (= G26), S142 (= S149), Y155 (= Y162), K159 (= K166)
- binding 1-phenylethanone: A93 (= A102), N95 (≠ F104), Y155 (= Y162), Y189 (≠ F194)
- binding nicotinamide-adenine-dinucleotide: G13 (= G22), L16 (≠ S25), I18 (= I27), D37 (= D46), H61 (≠ L69), D62 (= D70), S63 (≠ V71), N89 (= N98), A90 (= A99), I92 (≠ V101), M140 (≠ V147), Y155 (= Y162), G188 (≠ W193), I190 (≠ V195), L194 (≠ I199)
1zjzA Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and NAD (see paper)
34% identity, 74% coverage: 16:217/273 of query aligns to 7:211/251 of 1zjzA
- active site: G17 (= G26), S142 (= S149), Y155 (= Y162), K159 (= K166)
- binding nicotinamide-adenine-dinucleotide: G13 (= G22), L16 (≠ S25), I18 (= I27), D37 (= D46), D62 (= D70), N89 (= N98), A90 (= A99), G91 (= G100), I92 (≠ V101), Y155 (= Y162), G188 (≠ W193), I190 (≠ V195), L194 (≠ I199)
- binding (1r)-1-phenylethanol: A93 (= A102), N95 (≠ F104), L152 (= L159), Y155 (= Y162)
1zjyA Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and nadh (see paper)
34% identity, 74% coverage: 16:217/273 of query aligns to 7:211/251 of 1zjyA
- active site: G17 (= G26), S142 (= S149), Y155 (= Y162), K159 (= K166)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G13 (= G22), L16 (≠ S25), G17 (= G26), I18 (= I27), D37 (= D46), D62 (= D70), N89 (= N98), A90 (= A99), G91 (= G100), I92 (≠ V101), Y155 (= Y162), G188 (≠ W193), I190 (≠ V195), L194 (≠ I199)
- binding (1r)-1-phenylethanol: A93 (= A102), N95 (≠ F104), L152 (= L159), Y155 (= Y162), Y189 (≠ F194)
6wprA Crystal structure of a putative 3-oxoacyl-acp reductase (fabg) with NADP(h) from acinetobacter baumannii (see paper)
32% identity, 74% coverage: 15:215/273 of query aligns to 5:204/244 of 6wprA
- active site: G16 (= G26), S138 (= S149), Y151 (= Y162)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G22), S14 (≠ A24), R15 (≠ S25), T37 (≠ I47), L58 (= L69), D59 (= D70), V60 (= V71), N86 (= N98), A87 (= A99), G88 (= G100), I89 (≠ V101), I136 (≠ V147), Y151 (= Y162), K155 (= K166), P181 (= P192)
3p19A Improved NADPH-dependent blue fluorescent protein (see paper)
33% identity, 80% coverage: 15:232/273 of query aligns to 2:215/239 of 3p19A
- active site: S132 (= S149), Y145 (= Y162), K149 (= K166)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G22), S11 (≠ A24), S12 (= S25), G13 (= G26), I14 (= I27), A33 (≠ D46), R34 (≠ I47), R35 (≠ D48), D53 (= D70), V54 (= V71), N80 (= N98), A81 (= A99), G82 (= G100), I130 (≠ V147), S132 (= S149), Y145 (= Y162), K149 (= K166), P175 (= P192), A177 (≠ F194), V178 (= V195), T180 (= T197), E181 (≠ P198), L182 (≠ I199)
1zk4A Structure of r-specific alcohol dehydrogenase (wildtype) from lactobacillus brevis in complex with acetophenone and NADP (see paper)
33% identity, 74% coverage: 16:217/273 of query aligns to 7:211/251 of 1zk4A
- active site: G17 (= G26), S142 (= S149), Y155 (= Y162), K159 (= K166)
- binding 1-phenylethanone: A93 (= A102), Y155 (= Y162), Y189 (≠ F194)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G22), T15 (≠ A24), L16 (≠ S25), I18 (= I27), T36 (≠ S45), G37 (vs. gap), R38 (≠ D46), H61 (≠ L69), D62 (= D70), N89 (= N98), A90 (= A99), G91 (= G100), I92 (≠ V101), Y155 (= Y162), G188 (≠ W193), I190 (≠ V195), T192 (= T197), L194 (≠ I199)
6y0sAAA R-specific alcohol dehydrogenase (see paper)
33% identity, 74% coverage: 16:217/273 of query aligns to 7:211/251 of 6y0sAAA
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
34% identity, 72% coverage: 16:211/273 of query aligns to 5:203/246 of 3osuA
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
33% identity, 66% coverage: 19:199/273 of query aligns to 8:189/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G22), M16 (≠ I27), D35 (= D46), I36 (= I47), I62 (≠ V71), N88 (= N98), G90 (= G100), I138 (≠ V147), S140 (= S149), Y152 (= Y162), K156 (= K166), I185 (≠ V195)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
33% identity, 66% coverage: 19:199/273 of query aligns to 9:190/248 of Q9KJF1
- S15 (= S25) binding
- D36 (= D46) binding
- D62 (= D70) binding
- I63 (≠ V71) binding
- N89 (= N98) binding
- Y153 (= Y162) binding
- K157 (= K166) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
6qheA Alcohol dehydrogenase from arthrobacter sp. Ts-15 in complex with NAD+
32% identity, 72% coverage: 19:215/273 of query aligns to 11:209/261 of 6qheA
- binding nicotinamide-adenine-dinucleotide: G14 (= G22), M17 (≠ S25), G18 (= G26), M19 (≠ I27), D38 (= D48), R39 (≠ K49), D63 (= D70), I64 (≠ V71), A90 (≠ N98), A91 (= A99), S142 (= S149), Y156 (= Y162), K160 (= K166), P186 (= P192), G187 (≠ W193), M189 (≠ V195), T191 (= T197), P192 (= P198), M193 (≠ I199)
5itvD Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
32% identity, 67% coverage: 16:197/273 of query aligns to 8:189/227 of 5itvD
- active site: G18 (= G26), S141 (= S149), Y154 (= Y162), K158 (= K166)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G22), S17 (= S25), G18 (= G26), I19 (= I27), D38 (= D46), I39 (= I47), T61 (≠ L69), D62 (= D70), I63 (≠ V71), N89 (= N98), T139 (≠ V147), S141 (= S149), Y154 (= Y162), K158 (= K166), P184 (= P192), G185 (≠ W193), I187 (≠ V195)
Query Sequence
>CCNA_03061 CCNA_03061 SDR family dehydrogenase, group 9
MITMIREGSMPANGRKSIFITGAASGIGLACAKRFAQEGWFVGLSDIDKVGLKAALLAVG
PENGSIHPLDVRDREAWENAIGEFGRETGGKANALLNNAGVARFGMLNEMSDADCDIQID
INLKGVINGARAGLPLLKAAGGRLINVASCAGLYGSPKLAVYSATKFAVRGLSEALDVEY
AAYGVSVACVMPWFVETPILNAASDGSNKSMSESLKAGGLEVYPVEDAAQVVWEAAHGKA
LHYLVGKRAKQMRFAASHMPGSLRKQLRSRPLL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory