Comparing CCNA_03097 FitnessBrowser__Caulo:CCNA_03097 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q3L181 Perakine reductase; EC 1.1.1.317 from Rauvolfia serpentina (Serpentine wood) (Ophioxylon serpentinum) (see paper)
48% identity, 94% coverage: 9:321/333 of query aligns to 10:317/337 of Q3L181
3v0sA Crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during NADPH binding (see paper)
46% identity, 92% coverage: 9:314/333 of query aligns to 10:278/287 of 3v0sA
O14295 Pyridoxal reductase; PL reductase; PL-red; EC 1.1.1.65 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
32% identity, 95% coverage: 9:325/333 of query aligns to 6:325/333 of O14295
8hnqA The structure of a alcohol dehydrogenase akr13b2 with NADP
35% identity, 92% coverage: 5:309/333 of query aligns to 18:285/286 of 8hnqA
P46336 Aldo-keto reductase IolS; AKR11A; Vegetative protein 147; VEG147; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
34% identity, 93% coverage: 1:309/333 of query aligns to 1:305/310 of P46336
1pz0A Structure of NADPH-dependent family 11 aldo-keto reductase akr11a(holo) (see paper)
34% identity, 90% coverage: 10:309/333 of query aligns to 10:304/311 of 1pz0A
1pz1A Structure of NADPH-dependent family 11 aldo-keto reductase akr11b(holo) (see paper)
35% identity, 81% coverage: 9:279/333 of query aligns to 10:277/333 of 1pz1A
Sites not aligning to the query:
P80874 Aldo-keto reductase YhdN; AKR11B; General stress protein 69; GSP69; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
35% identity, 81% coverage: 9:279/333 of query aligns to 10:277/331 of P80874
Sites not aligning to the query:
6ow0B Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
34% identity, 96% coverage: 1:321/333 of query aligns to 1:300/301 of 6ow0B
4aubB The complex structure of the bacterial aldo-keto reductase akr14a1 with NADP and citrate (see paper)
32% identity, 96% coverage: 1:319/333 of query aligns to 11:327/335 of 4aubB
Sites not aligning to the query:
Q9P7U2 Putative aryl-alcohol dehydrogenase C977.14c; EC 1.1.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
33% identity, 95% coverage: 7:321/333 of query aligns to 14:350/351 of Q9P7U2
6ow0A Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
33% identity, 93% coverage: 1:309/333 of query aligns to 1:312/323 of 6ow0A
3n6qD Crystal structure of yghz from e. Coli (see paper)
30% identity, 96% coverage: 1:319/333 of query aligns to 12:314/315 of 3n6qD
P77256 NADH-specific methylglyoxal reductase; AKR11B2; EC 1.1.1.- from Escherichia coli (strain K12) (see paper)
34% identity, 91% coverage: 1:302/333 of query aligns to 1:310/326 of P77256
8hw0A The structure of akr6d1
31% identity, 89% coverage: 1:297/333 of query aligns to 1:301/329 of 8hw0A
5t79A X-ray crystal structure of a novel aldo-keto reductases for the biocatalytic conversion of 3-hydroxybutanal to 1,3-butanediol (see paper)
29% identity, 93% coverage: 1:311/333 of query aligns to 13:311/315 of 5t79A
3erpA Structure of idp01002, a putative oxidoreductase from and essential gene of salmonella typhimurium (see paper)
29% identity, 93% coverage: 1:311/333 of query aligns to 12:306/312 of 3erpA
8jwmB Crystal structure of akrtyl-NADP-tylosin complex (see paper)
30% identity, 94% coverage: 1:314/333 of query aligns to 1:320/331 of 8jwmB
4aubF The complex structure of the bacterial aldo-keto reductase akr14a1 with NADP and citrate (see paper)
29% identity, 93% coverage: 1:309/333 of query aligns to 11:294/298 of 4aubF
6hg6A Clostridium beijerinckii aldo-keto reductase cbei_3974 with NADPH (see paper)
29% identity, 93% coverage: 1:309/333 of query aligns to 12:307/313 of 6hg6A
>CCNA_03097 FitnessBrowser__Caulo:CCNA_03097
MKTRELGDGLKVSAIGLGCMGMGQVYGTALETGDAFKLMARAVELGVTFFDTAEVYGPFA
NEELVGQGLKPFRDQVVIATKFGFDIGPEDLGQGMARVRGVNSRPEHIRSVAEASLKRLG
IETIDLFYQHRVDPAVPIEDVAGTVKDLIAEGKVKHFGLSEAGAATIRKAHAIQPVAALQ
SEYSLWFRELEAEILPTLRELKIGLVPYSPLGRGFLAGAVKAETMGEGDFRKGLPRFQGE
ALQKNLSLVEALSAIAADKGVTPAQLALAWILHQGHDIAPIPGTTKIHRLEENVAAVDVT
FSADELARIAAAVPETEIEGERYSKTGMAMVGR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory