SitesBLAST
Comparing CCNA_03124 FitnessBrowser__Caulo:CCNA_03124 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7aauC Crystal structure of nitrosoglutathione reductase from chlamydomonas reinhardtii in complex with NAD+ (see paper)
40% identity, 99% coverage: 2:365/366 of query aligns to 12:378/378 of 7aauC
- active site: C48 (= C38), T50 (≠ S40), Y53 (≠ H43), H70 (= H59), C178 (= C167)
- binding nicotinamide-adenine-dinucleotide: T182 (= T171), G203 (= G192), G205 (= G194), V207 (= V196), D227 (= D216), I228 (≠ R217), C272 (≠ A260), I273 (= I261), V296 (≠ I283), G297 (= G284), V298 (≠ M285), A322 (≠ Y309), F323 (≠ M310), R373 (= R360)
- binding zinc ion: C48 (= C38), H70 (= H59), C100 (= C89), C103 (= C92), C106 (= C95), C114 (= C103), C178 (= C167)
P00325 All-trans-retinol dehydrogenase [NAD(+)] ADH1B; Alcohol dehydrogenase 1B; Alcohol dehydrogenase subunit beta; EC 1.1.1.105 from Homo sapiens (Human) (see 9 papers)
38% identity, 99% coverage: 2:365/366 of query aligns to 11:375/375 of P00325
- H48 (= H39) to R: in dbSNP:rs1229984
- N57 (≠ S48) to K: in dbSNP:rs1041969
- T60 (≠ H51) to S: in dbSNP:rs6413413
- R370 (= R360) to C: in beta-3/Indianapolis; allele ADH1B*3; decreased NAD(H) binding; dbSNP:rs2066702
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylserine
1u3wA Crystal structure of human alcohol dehydrogenase gamma-2-gamma-2 isoform complexed with n-1-methylheptylformamide determined to 1.45 angstrom resolution (see paper)
38% identity, 99% coverage: 2:365/366 of query aligns to 10:374/374 of 1u3wA
- active site: C46 (= C38), R47 (≠ H39), S48 (= S40), H51 (= H43), H67 (= H59), E68 (= E60), C97 (= C89), C100 (= C92), C103 (= C95), C111 (= C103), D115 (≠ E107), C174 (= C167), T178 (= T171), R369 (= R360)
- binding 1-methylheptylformamide: S48 (= S40), H67 (= H59), F93 (≠ L85), C174 (= C167)
- binding nicotinamide-adenine-dinucleotide: C46 (= C38), R47 (≠ H39), S48 (= S40), H51 (= H43), C174 (= C167), T178 (= T171), G199 (= G192), G201 (= G194), V203 (= V196), D223 (= D216), I224 (≠ R217), K228 (= K221), V268 (≠ A260), I269 (= I261), T274 (= T266), V292 (≠ I283), G293 (= G284), V294 (≠ M285), I318 (≠ Y309)
- binding zinc ion: C46 (= C38), H67 (= H59), C97 (= C89), C100 (= C92), C103 (= C95), C111 (= C103), C174 (= C167)
P00326 Alcohol dehydrogenase 1C; Alcohol dehydrogenase subunit gamma; EC 1.1.1.1 from Homo sapiens (Human) (see 5 papers)
38% identity, 99% coverage: 2:365/366 of query aligns to 11:375/375 of P00326
- C47 (= C38) binding
- R48 (≠ H39) to H: in dbSNP:rs35385902
- H68 (= H59) binding
- C98 (= C89) binding
- C101 (= C92) binding
- C104 (= C95) binding
- C112 (= C103) binding
- P166 (= P158) to S: in dbSNP:rs34195308
- C175 (= C167) binding
- GLGGVG 200:205 (≠ GCGGVG 192:197) binding
- D224 (= D216) binding
- K229 (= K221) binding
- R272 (≠ L263) to Q: in allele ADH3*2/gamma-2; dbSNP:rs1693482
- VGV 293:295 (≠ IGM 283:285) binding
- AIF 318:320 (≠ SYM 308:310) binding
- I350 (≠ R340) to V: in allele ADH3*2/gamma-2; dbSNP:rs698
- P352 (≠ K342) to T: in dbSNP:rs35719513
- R370 (= R360) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylserine
P19631 Alcohol dehydrogenase 1; ADH3; Alcohol dehydrogenase subunit alpha; EC 1.1.1.1 from Coturnix japonica (Japanese quail) (Coturnix coturnix japonica) (see paper)
38% identity, 99% coverage: 2:365/366 of query aligns to 10:375/375 of P19631
Sites not aligning to the query:
- 1 modified: N-acetylserine
P80512 Alcohol dehydrogenase 1; EC 1.1.1.1 from Naja naja (Indian cobra) (see paper)
37% identity, 99% coverage: 2:365/366 of query aligns to 10:375/375 of P80512
Sites not aligning to the query:
- 1 modified: N-acetylserine
P80467 Alcohol dehydrogenase class-3; Alcohol dehydrogenase class-III; Glutathione-dependent formaldehyde dehydrogenase; FALDH; FDH; GSH-FDH; S-(hydroxymethyl)glutathione dehydrogenase; EC 1.1.1.1; EC 1.1.1.-; EC 1.1.1.284 from Saara hardwickii (Indian spiny-tailed lizard) (Uromastyx hardwickii) (see paper)
37% identity, 99% coverage: 2:365/366 of query aligns to 8:373/373 of P80467
Sites not aligning to the query:
- 1 modified: N-acetylalanine
P80468 All-trans-retinol dehydrogenase [NAD(+)] ADH4; Alcohol dehydrogenase 4; Alcohol dehydrogenase class II; EC 1.1.1.105 from Struthio camelus (Common ostrich) (see 2 papers)
36% identity, 99% coverage: 2:365/366 of query aligns to 10:379/379 of P80468
Sites not aligning to the query:
- 1 modified: N-acetylthreonine
P25405 Alcohol dehydrogenase 1A; Alcohol dehydrogenase I-A; ADH IA; EC 1.1.1.1 from Saara hardwickii (Indian spiny-tailed lizard) (Uromastyx hardwickii) (see paper)
38% identity, 99% coverage: 2:365/366 of query aligns to 10:375/375 of P25405
Sites not aligning to the query:
- 1 modified: N-acetylglycine
1u3vA Crystal structure of human alcohol dehydrogenase beta-1-beta-1 isoform complexed with n-heptylformamide determined to 1.65 angstrom resolution (see paper)
38% identity, 99% coverage: 2:365/366 of query aligns to 10:374/374 of 1u3vA
- active site: C46 (= C38), R47 (≠ H39), T48 (≠ S40), H51 (= H43), H67 (= H59), E68 (= E60), C97 (= C89), C100 (= C92), C103 (= C95), C111 (= C103), D115 (≠ E107), C174 (= C167), T178 (= T171), R369 (= R360)
- binding heptylformamide: T48 (≠ S40), H67 (= H59), F93 (≠ L85), L116 (vs. gap), C174 (= C167)
- binding nicotinamide-adenine-dinucleotide: R47 (≠ H39), T48 (≠ S40), H51 (= H43), C174 (= C167), T178 (= T171), G199 (= G192), L200 (≠ C193), G201 (= G194), V203 (= V196), D223 (= D216), I224 (≠ R217), V268 (≠ A260), I269 (= I261), R271 (≠ L263), V292 (≠ I283), G293 (= G284), V294 (≠ M285), V318 (≠ Y309)
- binding zinc ion: C46 (= C38), H67 (= H59), C97 (= C89), C100 (= C92), C103 (= C95), C111 (= C103), C174 (= C167)
1u3uA Crystal structure of human alcohol dehydrogenase beta-1-beta-1 isoform complexed with n-benzylformamide determined to 1.6 angstrom resolution (see paper)
38% identity, 99% coverage: 2:365/366 of query aligns to 10:374/374 of 1u3uA
- active site: C46 (= C38), R47 (≠ H39), T48 (≠ S40), H51 (= H43), H67 (= H59), E68 (= E60), C97 (= C89), C100 (= C92), C103 (= C95), C111 (= C103), D115 (≠ E107), C174 (= C167), T178 (= T171), R369 (= R360)
- binding n-benzylformamide: T48 (≠ S40), H67 (= H59), F93 (≠ L85), C174 (= C167), V294 (≠ M285)
- binding nicotinamide-adenine-dinucleotide: R47 (≠ H39), T48 (≠ S40), H51 (= H43), C174 (= C167), T178 (= T171), G199 (= G192), L200 (≠ C193), G201 (= G194), V203 (= V196), D223 (= D216), I224 (≠ R217), K228 (= K221), V268 (≠ A260), I269 (= I261), R271 (≠ L263), V292 (≠ I283), G293 (= G284), V294 (≠ M285), V318 (≠ Y309), R369 (= R360)
- binding zinc ion: C46 (= C38), H67 (= H59), C97 (= C89), C100 (= C92), C103 (= C95), C111 (= C103), C174 (= C167)
1hdxB Three-dimensional structures of three human alcohol dehydrogenase variants: correlations with their functional differences (see paper)
38% identity, 99% coverage: 2:365/366 of query aligns to 10:374/374 of 1hdxB
- active site: C46 (= C38), R47 (≠ H39), T48 (≠ S40), H51 (= H43), H67 (= H59), E68 (= E60), C97 (= C89), C100 (= C92), C103 (= C95), C111 (= C103), D115 (≠ E107), C174 (= C167), T178 (= T171), R369 (= R360)
- binding cyclohexanol: L116 (vs. gap), V318 (≠ Y309)
- binding nicotinamide-adenine-dinucleotide: C46 (= C38), R47 (≠ H39), H51 (= H43), T178 (= T171), L200 (≠ C193), G201 (= G194), G202 (= G195), V203 (= V196), D223 (= D216), I269 (= I261), R271 (≠ L263), V292 (≠ I283), G293 (= G284), V294 (≠ M285), R369 (= R360)
- binding zinc ion: C46 (= C38), H67 (= H59), C97 (= C89), C100 (= C92), C103 (= C95), C111 (= C103), C174 (= C167)
1dehA Crystallization of human beta1 alcohol dehydrogenase (15 mg/ml) in 50 mm sodium phosphate (ph 7.5), 2.0 mm NAD+ and 1 mm 4-iodopyrazole at 25 oc, 13% (w/v) peg 8000 (see paper)
38% identity, 99% coverage: 2:365/366 of query aligns to 10:374/374 of 1dehA
- active site: C46 (= C38), R47 (≠ H39), T48 (≠ S40), H51 (= H43), H67 (= H59), E68 (= E60), C97 (= C89), C100 (= C92), C103 (= C95), C111 (= C103), D115 (≠ E107), C174 (= C167), T178 (= T171), R369 (= R360)
- binding nicotinamide-adenine-dinucleotide: C46 (= C38), R47 (≠ H39), T48 (≠ S40), H51 (= H43), C174 (= C167), T178 (= T171), G201 (= G194), V203 (= V196), D223 (= D216), I224 (≠ R217), V268 (≠ A260), I269 (= I261), V292 (≠ I283), V294 (≠ M285)
- binding 4-iodopyrazole: T48 (≠ S40), H67 (= H59), F93 (≠ L85), L116 (vs. gap), C174 (= C167)
- binding zinc ion: C46 (= C38), H67 (= H59), C97 (= C89), C100 (= C92), C103 (= C95), C111 (= C103)
P80222 Alcohol dehydrogenase 1; Alcohol dehydrogenase, major; EC 1.1.1.1 from Alligator mississippiensis (American alligator) (see paper)
37% identity, 99% coverage: 2:365/366 of query aligns to 10:374/374 of P80222
Sites not aligning to the query:
- 1 modified: N-acetylserine
4gl4A Crystal structure of oxidized s-nitrosoglutathione reductase from arabidopsis thalina, complex with nadh
38% identity, 99% coverage: 2:363/366 of query aligns to 10:374/378 of 4gl4A
- active site: C46 (= C38), H47 (= H39), T48 (≠ S40), Y51 (≠ H43), H68 (= H59), E69 (= E60), C98 (= C89), C101 (= C92), C104 (= C95), C112 (= C103), R116 (≠ S105), C176 (= C167), T180 (= T171), R371 (= R360)
- binding 1,4-dihydronicotinamide adenine dinucleotide: H47 (= H39), Y94 (≠ L85), T180 (= T171), G203 (= G194), V205 (= V196), D225 (= D216), I226 (≠ R217), C270 (≠ A260), I271 (= I261), V294 (≠ I283), G295 (= G284), V296 (≠ M285), A320 (≠ Y309)
- binding zinc ion: C46 (= C38), H68 (= H59), E69 (= E60), C98 (= C89), C101 (= C92), C104 (= C95), C112 (= C103), C176 (= C167)
3ukoA Crystal structure of s-nitrosoglutathione reductase from arabidopsis thaliana, complex with nadh
38% identity, 99% coverage: 2:363/366 of query aligns to 10:374/378 of 3ukoA
- active site: C46 (= C38), H47 (= H39), T48 (≠ S40), Y51 (≠ H43), H68 (= H59), E69 (= E60), C98 (= C89), C101 (= C92), C104 (= C95), C112 (= C103), R116 (≠ S105), C176 (= C167), T180 (= T171), R371 (= R360)
- binding nicotinamide-adenine-dinucleotide: H47 (= H39), T180 (= T171), G203 (= G194), V205 (= V196), D225 (= D216), I226 (≠ R217), K230 (= K221), C270 (≠ A260), I271 (= I261), V294 (≠ I283), G295 (= G284), V296 (≠ M285), A320 (≠ Y309)
- binding zinc ion: C46 (= C38), H68 (= H59), E69 (= E60), C98 (= C89), C101 (= C92), C104 (= C95), C112 (= C103), C176 (= C167)
8co4C Alcohol dehydrogenase class-3 (see paper)
38% identity, 99% coverage: 2:363/366 of query aligns to 11:375/379 of 8co4C
Q96533 Alcohol dehydrogenase class-3; Alcohol dehydrogenase class-III; Glutathione-dependent formaldehyde dehydrogenase; FALDH; FDH; GSH-FDH; S-(hydroxymethyl)glutathione dehydrogenase; EC 1.1.1.1; EC 1.1.1.-; EC 1.1.1.284 from Arabidopsis thaliana (Mouse-ear cress)
38% identity, 99% coverage: 2:363/366 of query aligns to 11:375/379 of Q96533
P23991 Alcohol dehydrogenase 1; ADH-1; Alcohol dehydrogenase I; EC 1.1.1.1 from Gallus gallus (Chicken) (see paper)
37% identity, 99% coverage: 2:365/366 of query aligns to 11:376/376 of P23991
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylserine
P81601 Alcohol dehydrogenase class-3 chain L; Alcohol dehydrogenase class-III chain L; Glutathione-dependent formaldehyde dehydrogenase; FALDH; FDH; GSH-FDH; S-(hydroxymethyl)glutathione dehydrogenase; EC 1.1.1.1; EC 1.1.1.-; EC 1.1.1.284 from Gadus morhua (Atlantic cod) (see 2 papers)
37% identity, 99% coverage: 2:365/366 of query aligns to 10:375/375 of P81601
Sites not aligning to the query:
- 1 modified: N-acetylalanine
Query Sequence
>CCNA_03124 FitnessBrowser__Caulo:CCNA_03124
MKAAVLREVGKPLQIETVAIGKPGPREVLIRTKAAGVCHSDLHFVEGSYTHALPAVLGHE
SAGIVEAVGSEVRTVKVGDHVITCLNPYCGHCEVCLTGHMNLCISPETRRSKSDAPRLFK
EDLNGATGPMAQFLNLSSFAEMMLVHEHACVAIRKDMPFDRAALIGCSVMTGVGAVMHTS
NVRPGETVAVIGCGGVGLATINGAAIAGAGRIIAIDRLAGKLELAKTFGATDVVDASQVD
DIAKAVVELTGGGVHHSFEAIGLKATAEASFKMLRRGGTANVIGMIPVGTKIELHGVDFL
GERRIQGSYMGSNRFPVDMPRLVDFYMSGKLKLDELISRRIKLEDVNSAFDELKRGELAR
SVIVFD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory