Comparing CCNA_03149 FitnessBrowser__Caulo:CCNA_03149 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7zgzX Crystal structure of beta-xylosidase from thermotoga maritima in complex with methyl-beta-d-xylopyranoside hydrolysed to xylose
43% identity, 94% coverage: 41:801/806 of query aligns to 3:725/753 of 7zgzX
7zdyW Crystal structure of beta-xylosidase from thermotoga maritima in complex with methyl-beta-d-xylopyranoside
42% identity, 94% coverage: 41:801/806 of query aligns to 3:736/763 of 7zdyW
7zb3A Crystal structure of beta-xylosidase from thermotoga maritima in complex with xylohexaose hydrolysed to xylobiose
42% identity, 94% coverage: 41:801/806 of query aligns to 3:736/765 of 7zb3A
8c7fA Crystal structure of beta-xylosidase mutant (d281n, e517q) from thermotoga maritima in complex with xylopentaose
41% identity, 94% coverage: 41:801/806 of query aligns to 3:745/772 of 8c7fA
5z87A Structural of a novel b-glucosidase emgh1 at 2.3 angstrom from erythrobacter marinus
41% identity, 93% coverage: 60:805/806 of query aligns to 25:755/756 of 5z87A
3u48B From soil to structure: a novel dimeric family 3-beta-glucosidase isolated from compost using metagenomic analysis
37% identity, 93% coverage: 53:804/806 of query aligns to 6:733/742 of 3u48B
6r5nA The crystal structure of glycoside hydrolase bglx from p. Aeruginosa in complex with 1-deoxynojirimycin (see paper)
37% identity, 82% coverage: 147:805/806 of query aligns to 65:732/733 of 6r5nA
6r5iA The crystal structure of the glycoside hydrolase bglx from p. Aeruginosa (see paper)
37% identity, 82% coverage: 147:805/806 of query aligns to 65:732/733 of 6r5iA
6r5vA The crystal structure of glycoside hydrolase bglx inactive mutant d286n from p. Aeruginosa in complex with xylotriose (see paper)
37% identity, 82% coverage: 147:805/806 of query aligns to 65:729/730 of 6r5vA
6r5oA The crystal structure the glycoside hydrolase bglx inactive mutant d286n from p. Aeruginosa in complex with two glucose molecules (see paper)
37% identity, 82% coverage: 147:805/806 of query aligns to 65:729/730 of 6r5oA
6r5tA The crystal structure of glycoside hydrolase bglx inactive mutant d286n from p. Aeruginosa in complex with lactose (see paper)
37% identity, 82% coverage: 147:805/806 of query aligns to 65:732/733 of 6r5tA
Sites not aligning to the query:
5yqsA Isoprimeverose-producing enzyme from aspergillus oryzae in complex with isoprimeverose (see paper)
38% identity, 94% coverage: 39:799/806 of query aligns to 1:746/754 of 5yqsA
7eapA Crystal structure of ipea-xxxg complex (see paper)
38% identity, 94% coverage: 39:799/806 of query aligns to 2:747/755 of 7eapA
5tf0A Crystal structure of glycosil hydrolase family 3 n-terminal domain protein from bacteroides intestinalis
35% identity, 94% coverage: 47:805/806 of query aligns to 1:733/733 of 5tf0A
5xxmA Crystal structure of gh3 beta-glucosidase from bacteroides thetaiotaomicron in complex with gluconolactone (see paper)
35% identity, 94% coverage: 47:805/806 of query aligns to 3:746/749 of 5xxmA
5xxnA Crystal structure of mutant (d286n) beta-glucosidase from bacteroides thetaiotaomicron in complex with sophorose (see paper)
36% identity, 84% coverage: 126:805/806 of query aligns to 43:735/744 of 5xxnA
4zobA Crystal structure of beta-glucosidase from listeria innocua in complex with gluconolactone (see paper)
33% identity, 93% coverage: 52:798/806 of query aligns to 5:710/722 of 4zobA
4zoaA Crystal structure of beta-glucosidase from listeria innocua in complex with isofagomine (see paper)
33% identity, 93% coverage: 52:798/806 of query aligns to 5:704/716 of 4zoaA
4zo7A Crystal structure of mutant (d270a) beta-glucosidase from listeria innocua in complex with gentiobiose (see paper)
33% identity, 93% coverage: 52:798/806 of query aligns to 5:712/724 of 4zo7A
4zo6B Crystal structure of mutant (d270a) beta-glucosidase from listeria innocua in complex with cellobiose (see paper)
33% identity, 93% coverage: 52:798/806 of query aligns to 5:712/724 of 4zo6B
>CCNA_03149 FitnessBrowser__Caulo:CCNA_03149
MNTTLTRRLFGASLAALSAAALPSLAQAAGQAPKTSGGKPLYKDPTQPVDARIQDLLSRM
TLEEKAAQLIGIWLTKAKIQTPEGEFSAEQASKNFPHGLGQISRPSDRKGAKPVTVIGAA
AGADDGAINRNAAETARYTNAAQKWAIEKTRLGIPLLMHDEALHGYVARDATSFPQSIAL
ASTFDTELTEKIFAVAAREMRARGSNLALAPVVDVARDPRWGRIEETYGEDPHLCAEIGL
ASIRGFQGATLPLAKDKVFVTLKHMTGHGQPENGTNVGPAQIAERTLRENFFPPFERAVT
ELPVRAVMPSYNEIDGVPSHANRWLLTKILREEWGYKGSIQSDYFAIKEMISRHKLTSDL
GETAVMAMRAGVDVELPDGEAYALIPELVKAGRIPQFEVDAAVARVLEMKFQAGLFENPY
CDEKTADAKTATPDAVALAREAARKSVVLLKNDKGLLPLDGKKFKRMALLGTHAKDTPIG
GYSDIPRHVVSIHEGLTAEAKAQGFALDYAEAVRITEQRIWAQDAVNFTDPAVNAKLIAE
AVEVAKKADIVVMVLGDNEQTSREAWADHHLGDRDSLDLMGQQNDLARAIFDLGKPTVVF
LLNGRPLSINLLKERADAIIEGWYLGQETGHAAADVLFGRANPGGKLPVSIARDVGQLPV
YYNRKPTARRGYLDGETTPLYPFGFGLSYTTFDVSAPRLAKAKIGQGETVKVEVDVTNTG
KVAGDEVVQLYVHDEAASVTRPVLELKHFKRVTLAPGAKTTVTFEIKPSDLWMWNLDMKR
VVEPGDFSILVGPNSVDLKKTTLTVA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory