Comparing CCNA_03190 FitnessBrowser__Caulo:CCNA_03190 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
O50584 Low specificity L-threonine aldolase; Low specificity L-TA; EC 4.1.2.48 from Pseudomonas sp. (strain NCIMB 10558) (see paper)
44% identity, 97% coverage: 11:343/344 of query aligns to 8:343/346 of O50584
5vyeB Crystal structure of l-threonine aldolase from pseudomonas putida
43% identity, 97% coverage: 11:343/344 of query aligns to 6:341/344 of 5vyeB
1v72A Crystal structure of phenylserine aldolase from pseudomonas putida
36% identity, 96% coverage: 7:336/344 of query aligns to 3:337/345 of 1v72A
3wlxA Crystal structure of low-specificity l-threonine aldolase from escherichia coli
27% identity, 77% coverage: 10:274/344 of query aligns to 3:273/331 of 3wlxA
Sites not aligning to the query:
1lw5B X-ray structure of l-threonine aldolase (low-specificity) in complex with glycine (see paper)
24% identity, 95% coverage: 10:335/344 of query aligns to 3:330/343 of 1lw5B
1lw4B X-ray structure of l-threonine aldolase (low-specificity) in complex with l-allo-threonine (see paper)
24% identity, 95% coverage: 10:335/344 of query aligns to 3:330/343 of 1lw4B
1jg8D Crystal structure of threonine aldolase (low-specificity)
24% identity, 95% coverage: 10:335/344 of query aligns to 4:331/344 of 1jg8D
4rjyA Crystal structure of e. Coli l-threonine aldolase in complex with a non-covalently uncleaved bound l-serine substrate (see paper)
27% identity, 77% coverage: 10:274/344 of query aligns to 3:273/332 of 4rjyA
4lnlA Structure of escherichia coli threonine aldolase in complex with allo- thr (see paper)
27% identity, 77% coverage: 10:274/344 of query aligns to 3:273/332 of 4lnlA
Sites not aligning to the query:
4lnjA Structure of escherichia coli threonine aldolase in unliganded form (see paper)
27% identity, 77% coverage: 10:274/344 of query aligns to 3:273/332 of 4lnjA
4lnmA Structure of escherichia coli threonine aldolase in complex with serine (see paper)
27% identity, 77% coverage: 10:274/344 of query aligns to 3:273/331 of 4lnmA
3wgcB Aeromonas jandaei l-allo-threonine aldolase h128y/s292r double mutant (see paper)
33% identity, 52% coverage: 8:185/344 of query aligns to 1:175/333 of 3wgcB
Sites not aligning to the query:
O07051 L-allo-threonine aldolase; L-allo-TA; L-allo-threonine acetaldehyde-lyase; EC 4.1.2.49 from Aeromonas jandaei (see paper)
32% identity, 52% coverage: 8:185/344 of query aligns to 2:176/338 of O07051
Sites not aligning to the query:
3wgbD Crystal structure of aeromonas jandaei l-allo-threonine aldolase (see paper)
35% identity, 36% coverage: 63:185/344 of query aligns to 54:172/324 of 3wgbD
Sites not aligning to the query:
Q8RXU4 Low-specificity L-threonine aldolase 1; Threonine aldolase 1; EC 4.1.2.48 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
25% identity, 86% coverage: 10:306/344 of query aligns to 7:307/358 of Q8RXU4
>CCNA_03190 FitnessBrowser__Caulo:CCNA_03190
MMTQTAPRYDFASDNVAGAMPEVMEALIAANAGTASGYGTDHVSRAAADRIRAALDADAQ
VRFTASGTAANAFALTLLAQPHEAVLAHEHAHICTDETGAPGFFGQGVGLIGLPGASGKM
ELAALEAALAQPDVSYRQPAAALSLTTATEYGTVYSEDHLRALIAPVKAKGYGVHLDGAR
LANAVAGGFDLKSIAKMGVDILVMGGTKAGSTPTEAVVFLNPDHAKRLDARLKHAGQLIS
KGRFLAAPWLGLLGENGQTAPWAARAAHANAMAQKLAALMPVPIKHPVEANGIFVEMDEL
ALERLRGEGWFVYRFLDGTVRFMCSWATTPEMVEDLGAALKRVA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory