SitesBLAST
Comparing CCNA_03215 FitnessBrowser__Caulo:CCNA_03215 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3wx9A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, gla, 4ad, 2og, glu and kya
27% identity, 65% coverage: 159:466/471 of query aligns to 68:395/404 of 3wx9A
- binding 2-oxoglutaric acid: D213 (= D299), P214 (≠ A300), Y215 (= Y301), G216 (= G302), E217 (≠ L303), G241 (≠ A324), T242 (= T325), I246 (≠ A329)
- binding (2E)-pent-2-enedioic acid: Y130 (= Y221), N184 (= N270), R376 (= R446)
- binding glutamic acid: L131 (≠ P222), V360 (= V430), A364 (= A434), R369 (≠ G439)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G195), S105 (≠ A196), Q106 (= Q197), Y130 (= Y221), N184 (= N270), D212 (= D298), P214 (≠ A300), Y215 (= Y301), T242 (= T325), S244 (≠ A327), K245 (= K328), R252 (= R335)
Sites not aligning to the query:
3av7A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, kyn as substrates and kya as products
27% identity, 65% coverage: 159:466/471 of query aligns to 68:395/404 of 3av7A
- binding 4-hydroxyquinoline-2-carboxylic acid: L131 (≠ P222), Q135 (≠ A226), A364 (= A434), R369 (≠ G439)
- binding (2S)-2-amino-4-(2-aminophenyl)-4-oxobutanoic acid: Y130 (= Y221), L131 (≠ P222), A132 (≠ G223), N184 (= N270), R376 (= R446)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G195), S105 (≠ A196), Q106 (= Q197), Y130 (= Y221), V179 (≠ T265), N184 (= N270), D212 (= D298), P214 (≠ A300), Y215 (= Y301), T242 (= T325), S244 (≠ A327), K245 (= K328), R252 (= R335)
Sites not aligning to the query:
3aowC Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with akg
27% identity, 65% coverage: 159:466/471 of query aligns to 68:395/404 of 3aowC
- binding 2-oxoglutaric acid: Y70 (= Y161), Y130 (= Y221), L275 (= L363)
- binding pyridoxal-5'-phosphate: G104 (= G195), S105 (≠ A196), Q106 (= Q197), Y130 (= Y221), V179 (≠ T265), N184 (= N270), D212 (= D298), P214 (≠ A300), Y215 (= Y301), T242 (= T325), S244 (≠ A327), K245 (= K328), R252 (= R335)
Sites not aligning to the query:
3aovA Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with plp
27% identity, 65% coverage: 159:466/471 of query aligns to 68:395/404 of 3aovA
- binding pyridoxal-5'-phosphate: G104 (= G195), S105 (≠ A196), Q106 (= Q197), Y130 (= Y221), V179 (≠ T265), N184 (= N270), D212 (= D298), P214 (≠ A300), Y215 (= Y301), T242 (= T325), S244 (≠ A327), K245 (= K328), R252 (= R335)
3cbfA Crystal structure of lysn, alpha-aminoadipate aminotransferase, from thermus thermophilus hb27 (see paper)
28% identity, 65% coverage: 159:465/471 of query aligns to 64:382/392 of 3cbfA
- binding (2S)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]hexanedioic acid: G95 (= G195), S96 (≠ A196), Q97 (= Q197), Y121 (= Y221), N170 (= N270), D198 (= D298), Y201 (= Y301), S231 (≠ T325), S233 (≠ A327), K234 (= K328), R241 (= R335), R364 (= R446)
Sites not aligning to the query:
2egyA Crystal structure of lysn, alpha-aminoadipate aminotransferase (substrate free form), from thermus thermophilus hb27
28% identity, 65% coverage: 159:465/471 of query aligns to 64:382/392 of 2egyA
- binding pyridoxal-5'-phosphate: G95 (= G195), S96 (≠ A196), Q97 (= Q197), Y121 (= Y221), N170 (= N270), D198 (= D298), A200 (= A300), Y201 (= Y301), S231 (≠ T325), S233 (≠ A327), K234 (= K328), R241 (= R335)
2zyjA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-glutamate), from thermus thermophilus hb27 (see paper)
28% identity, 65% coverage: 159:465/471 of query aligns to 68:386/397 of 2zyjA
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid: G99 (= G195), S100 (≠ A196), Q101 (= Q197), Y125 (= Y221), N174 (= N270), D202 (= D298), Y205 (= Y301), S235 (≠ T325), S237 (≠ A327), K238 (= K328), R245 (= R335), R368 (= R446)
Sites not aligning to the query:
Q72LL6 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; Alpha-aminoadipate aminotransferase; AAA-AT; AadAT; EC 2.6.1.39 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see 2 papers)
28% identity, 65% coverage: 159:465/471 of query aligns to 68:386/397 of Q72LL6
- Y70 (= Y161) binding
- N174 (= N270) binding ; binding
- R245 (= R335) binding
- R368 (= R446) binding
Sites not aligning to the query:
- 20 S→E: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate. Increases the affinity for leucine and 2-oxoisocaproate.
- 23 R→A: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.; R→Q: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.
- 40 binding
2z1yA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-leucine), from thermus thermophilus hb27
28% identity, 67% coverage: 150:465/471 of query aligns to 51:378/389 of 2z1yA
- binding leucine: Y117 (= Y221), R360 (= R446)
- binding pyridoxal-5'-phosphate: G91 (= G195), S92 (≠ A196), Q93 (= Q197), Y117 (= Y221), N166 (= N270), D194 (= D298), Y197 (= Y301), S227 (≠ T325), S229 (≠ A327), K230 (= K328), R237 (= R335)
Sites not aligning to the query:
6hnuB Crystal structure of the aminotransferase aro8 from c. Albicans with ligands (see paper)
26% identity, 47% coverage: 184:403/471 of query aligns to 125:374/480 of 6hnuB
- binding phenylalanine: F162 (≠ Y221), K296 (= K328)
- binding pyridoxal-5'-phosphate: G136 (= G195), N137 (≠ A196), T138 (≠ Q197), F162 (≠ Y221), I209 (≠ T265), D242 (= D298), Y245 (= Y301), S293 (≠ T325), S295 (≠ A327), K296 (= K328), R303 (= R335)
8tn3A Structure of s. Hygroscopicus aminotransferase mppq complexed with pyridoxamine 5'-phosphate (pmp) (see paper)
38% identity, 34% coverage: 184:341/471 of query aligns to 81:248/388 of 8tn3A
2zc0A Crystal structure of an archaeal alanine:glyoxylate aminotransferase (see paper)
30% identity, 49% coverage: 141:372/471 of query aligns to 53:286/405 of 2zc0A
- active site: Y132 (= Y221), D214 (= D298), A216 (= A300), S246 (≠ A327)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G106 (= G195), G107 (≠ A196), T108 (≠ Q197), Y132 (= Y221), N186 (= N270), D214 (= D298), A216 (= A300), Y217 (= Y301), T244 (= T325), S246 (≠ A327), K247 (= K328), R254 (= R335)
1wstA Crystal structure of multiple substrate aminotransferase (msat) from thermococcus profundus
28% identity, 46% coverage: 159:375/471 of query aligns to 65:290/403 of 1wstA
- binding pyridoxal-5'-phosphate: G102 (= G195), S103 (≠ A196), Q104 (= Q197), Y128 (= Y221), V177 (≠ T265), N182 (= N270), D210 (= D298), P212 (≠ A300), Y213 (= Y301), T240 (= T325), S242 (≠ A327), K243 (= K328), R250 (= R335)
6s8wC Aromatic aminotransferase aroh (aro8) form aspergillus fumigatus in complex with plp (internal aldimine)
26% identity, 50% coverage: 184:418/471 of query aligns to 154:419/470 of 6s8wC
4je5A Crystal structure of the aromatic aminotransferase aro8, a putative alpha-aminoadipate aminotransferase in saccharomyces cerevisiae (see paper)
25% identity, 47% coverage: 190:409/471 of query aligns to 130:384/494 of 4je5A
- binding 4-(2-hydroxyethyl)-1-piperazine ethanesulfonic acid: E169 (≠ R229), K269 (vs. gap), H272 (vs. gap)
- binding pyridoxal-5'-phosphate: G135 (= G195), N136 (≠ A196), T137 (≠ Q197), F161 (≠ Y221), I210 (≠ T265), D243 (= D298), P245 (≠ A300), Y246 (= Y301), S297 (≠ T325), S299 (≠ A327), K300 (= K328)
Sites not aligning to the query:
4je5B Crystal structure of the aromatic aminotransferase aro8, a putative alpha-aminoadipate aminotransferase in saccharomyces cerevisiae (see paper)
25% identity, 47% coverage: 190:409/471 of query aligns to 134:388/497 of 4je5B
- binding 4-(2-hydroxyethyl)-1-piperazine ethanesulfonic acid: F165 (≠ Y221)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G139 (= G195), N140 (≠ A196), T141 (≠ Q197), F165 (≠ Y221), I214 (≠ T265), D247 (= D298), P249 (≠ A300), Y250 (= Y301), S301 (≠ T325), S303 (≠ A327), R311 (= R335)
Sites not aligning to the query:
6s8wB Aromatic aminotransferase aroh (aro8) form aspergillus fumigatus in complex with plp (internal aldimine)
28% identity, 38% coverage: 184:361/471 of query aligns to 146:348/491 of 6s8wB
- binding pyridoxal-5'-phosphate: G157 (= G195), S158 (≠ A196), T159 (≠ Q197), F183 (≠ Y221), D268 (= D298), P270 (≠ A300), Y271 (= Y301), S312 (≠ T325), S314 (≠ A327), K315 (= K328), R322 (= R335)
3ue8A Kynurenine aminotransferase ii inhibitors (see paper)
23% identity, 43% coverage: 180:380/471 of query aligns to 87:302/410 of 3ue8A
- binding (5-hydroxy-4-{[(1-hydroxy-2-oxo-1,2-dihydroquinolin-3-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: S100 (≠ A196), Q101 (= Q197), Y125 (= Y221), N185 (= N270), D213 (= D298), P215 (≠ A300), Y216 (= Y301), S243 (≠ T325), S245 (≠ A327), K246 (= K328), R253 (= R335)
Sites not aligning to the query:
5tf5A Crystal structure of human kat-2 in complex with a reversible inhibitor
23% identity, 43% coverage: 180:380/471 of query aligns to 104:319/425 of 5tf5A
Sites not aligning to the query:
2r2nA The crystal structure of human kynurenine aminotransferase ii in complex with kynurenine (see paper)
23% identity, 43% coverage: 180:380/471 of query aligns to 104:319/425 of 2r2nA
- binding (2S)-2-amino-4-(2-aminophenyl)-4-oxobutanoic acid: Y142 (= Y221)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: S117 (≠ A196), Q118 (= Q197), Y142 (= Y221), N202 (= N270), D230 (= D298), P232 (≠ A300), Y233 (= Y301), S260 (≠ T325), S262 (≠ A327), K263 (= K328), R270 (= R335)
Sites not aligning to the query:
Query Sequence
>CCNA_03215 FitnessBrowser__Caulo:CCNA_03215
MKSPSYNRTIDPYITRSMYGYAVMPATKGSPNPAAAWLRRVEAFDGPAYRRIALALEAAV
AEGELQAGDQIPAQREVARLIGVDFTTVTRAYGLARERGLIEGTAGRGTFIRLRINEDEA
GLIDLSMNLPPPPQGLNLAGLLQDATRAILARTEPATLMAYHPGAGSLAQRSAGAAWLAP
TLGPVDPGRVVVTGGAQTALSALLDYLAAPGDTIIVEAFTYPGLLATARRRGLTLVACPL
DDEGLQPEALAQLVAQHGPRLICCTPTFQNPTAATMSPARRAAVIEIARAAGVTILEDDA
YGLLPASPAPALAALWPEGVYHVATTAKALSPGLRLAYVVAPPGCAEGFAQALHAIAQMP
APLMAGIVTQWIRDGVAAKVLAGVRSEAVARRALAATLLPRAVGDAESLHVWLAGAEAPP
AARERGLALVGANAFRAPGVTGEGLRISLGATAKRAALTQGLKALATLSAP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory