Comparing CCNA_03233 FitnessBrowser__Caulo:CCNA_03233 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ypmA Crystal structure of transaminase cc1012 complexed with plp and l- alanine (see paper)
90% identity, 97% coverage: 8:461/467 of query aligns to 1:454/454 of 7ypmA
7ypnD Crystal structure of transaminase cc1012 mutant m9 complexed with plp (see paper)
89% identity, 97% coverage: 8:462/467 of query aligns to 1:455/455 of 7ypnD
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
59% identity, 95% coverage: 12:453/467 of query aligns to 5:444/450 of 6gwiB
7qx3A Structure of the transaminase tr2e2 with eos (see paper)
55% identity, 90% coverage: 37:454/467 of query aligns to 1:417/422 of 7qx3A
7qx0B Transaminase structure of plurienzyme (tr2e2) in complex with plp (see paper)
53% identity, 95% coverage: 10:454/467 of query aligns to 2:438/443 of 7qx0B
6s4gA Crystal structure of the omega transaminase from chromobacterium violaceum in complex with pmp (see paper)
51% identity, 97% coverage: 10:460/467 of query aligns to 2:450/453 of 6s4gA
7q9xAAA Probable aminotransferase
51% identity, 97% coverage: 10:460/467 of query aligns to 3:451/455 of 7q9xAAA
4a6tC Crystal structure of the omega transaminase from chromobacterium violaceum in complex with plp (see paper)
51% identity, 97% coverage: 10:460/467 of query aligns to 3:451/455 of 4a6tC
4ba5A Crystal structure of omega-transaminase from chromobacterium violaceum (see paper)
52% identity, 91% coverage: 37:460/467 of query aligns to 1:423/427 of 4ba5A
4a6rA Crystal structure of the omega transaminase from chromobacterium violaceum in the apo form, crystallised from polyacrylic acid (see paper)
52% identity, 91% coverage: 38:460/467 of query aligns to 1:419/423 of 4a6rA
5ti8B Crystal structure of an aspartate aminotransferase from pseudomonas (see paper)
50% identity, 90% coverage: 38:457/467 of query aligns to 1:382/384 of 5ti8B
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
47% identity, 95% coverage: 9:453/467 of query aligns to 4:445/448 of 6io1B
5kr6B Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
44% identity, 95% coverage: 9:451/467 of query aligns to 8:453/460 of 5kr6B
5kquC Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
42% identity, 95% coverage: 9:453/467 of query aligns to 3:453/459 of 5kquC
5kr5A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
43% identity, 95% coverage: 12:453/467 of query aligns to 7:451/455 of 5kr5A
5kr3A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
43% identity, 95% coverage: 12:453/467 of query aligns to 7:452/458 of 5kr3A
5ghgB Transaminase w58l with smba
41% identity, 96% coverage: 13:458/467 of query aligns to 4:431/433 of 5ghgB
6g4fA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with pmp (see paper)
41% identity, 95% coverage: 11:453/467 of query aligns to 1:444/451 of 6g4fA
6g4eA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp and 6-aminohexanoate (6-aca) (see paper)
41% identity, 95% coverage: 11:453/467 of query aligns to 1:444/451 of 6g4eA
6g4dB Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp (see paper)
41% identity, 95% coverage: 11:453/467 of query aligns to 1:444/453 of 6g4dB
>CCNA_03233 FitnessBrowser__Caulo:CCNA_03233
MNAPIRNHDVAELKRLDLAHHLPAQADHKVIAELGGSRIVTRADGCYITDGDGHRILDGM
AGLWCVNVGYGRKELADAAYEQMLELPYYNTFFKTATPPTVKLAAKIAEKMGGHLTHVFF
NSSGSEANDTVFRLVRHYWKLKGQPNRTVFISRWNAYHGSTVAGVSLGGMKHMHVQGDLP
IPGVEHVMQPYPFGEGFGEDPAAFRDRAVKEIEDKILEVGPENVAAFIGEPVQGAGGVII
PPDGYWPAVEAVCRKYGILLVCDEVICGFGRLGQWFGHQHYGIKPDLIAMAKGLSSGYLP
ISAVGVADHIVAELREKGGDFIHGFTYSGHPTCAAVALKNIEIIEREDLITRTREDTGPY
LAKALARLNDHPLVGETRSLGLIGAVEIVREKGTNHRFLDKEGEAGPIVRDICIRNGLMV
RAIRDSIVCCPPLIVSHAEIDELVGIIEKSLTEAEPILRALKPEAVS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory