SitesBLAST
Comparing CCNA_03235 FitnessBrowser__Caulo:CCNA_03235 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
43% identity, 97% coverage: 9:379/381 of query aligns to 12:372/378 of P69874
- C26 (≠ R23) mutation to A: Lower ATPase activity and transport efficiency.
- F27 (= F24) mutation to L: Lower ATPase activity and transport efficiency.
- F45 (= F42) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (= C51) mutation to T: Loss of ATPase activity and transport.
- L60 (= L57) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (≠ I73) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (= V132) mutation to M: Loss of ATPase activity and transport.
- D172 (= D169) mutation to N: Loss of ATPase activity and transport.
- C276 (≠ V272) mutation to A: Lower ATPase activity and transport efficiency.
- E297 (= E295) mutation E->K,D: Lower ATPase activity and transport efficiency.; mutation to Q: Loss of ATPase activity and transport.
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
54% identity, 63% coverage: 19:258/381 of query aligns to 11:258/375 of 2d62A
1g291 Malk (see paper)
46% identity, 85% coverage: 19:342/381 of query aligns to 8:332/372 of 1g291
- binding magnesium ion: D69 (≠ N80), E71 (vs. gap), K72 (vs. gap), K79 (≠ N84), D80 (≠ K85), E292 (= E295), D293 (≠ K296)
- binding pyrophosphate 2-: S38 (= S49), G39 (= G50), C40 (= C51), G41 (= G52), K42 (= K53), T43 (= T54), T44 (= T55)
Sites not aligning to the query:
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
50% identity, 74% coverage: 15:297/381 of query aligns to 7:278/353 of 1vciA
8hplC Lpqy-sugabc in state 1 (see paper)
46% identity, 75% coverage: 15:298/381 of query aligns to 3:285/384 of 8hplC
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
41% identity, 89% coverage: 15:352/381 of query aligns to 4:330/369 of P19566
- L86 (≠ V97) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P171) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D176) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- E306 (≠ A328) mutation to K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
8hprC Lpqy-sugabc in state 4 (see paper)
46% identity, 75% coverage: 15:298/381 of query aligns to 3:287/363 of 8hprC
- binding adenosine-5'-triphosphate: Y12 (≠ F24), S38 (= S49), G39 (= G50), G41 (= G52), K42 (= K53), S43 (≠ T54), Q82 (= Q93), Q133 (= Q144), G136 (= G147), G137 (= G148), Q138 (= Q149), H192 (= H203)
- binding magnesium ion: S43 (≠ T54), Q82 (= Q93)
8hprD Lpqy-sugabc in state 4 (see paper)
46% identity, 75% coverage: 15:298/381 of query aligns to 3:287/362 of 8hprD
- binding adenosine-5'-triphosphate: Y12 (≠ F24), S38 (= S49), C40 (= C51), G41 (= G52), K42 (= K53), S43 (≠ T54), T44 (= T55), Q82 (= Q93), R129 (= R140), Q133 (= Q144), S135 (= S146), G136 (= G147), G137 (= G148), Q159 (≠ E170), H192 (= H203)
- binding magnesium ion: S43 (≠ T54), Q82 (= Q93)
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
50% identity, 61% coverage: 15:246/381 of query aligns to 3:234/374 of 2awnB
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
50% identity, 61% coverage: 15:246/381 of query aligns to 4:235/371 of P68187
- A85 (= A96) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ P117) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (= V125) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ A128) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (= E130) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ G135) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G148) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D169) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
- R228 (= R239) mutation to C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
Sites not aligning to the query:
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
50% identity, 61% coverage: 15:246/381 of query aligns to 3:234/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ F24), S37 (= S49), G38 (= G50), C39 (= C51), G40 (= G52), K41 (= K53), S42 (≠ T54), T43 (= T55), Q81 (= Q93), R128 (= R140), A132 (≠ Q144), S134 (= S146), G136 (= G148), Q137 (= Q149), E158 (= E170), H191 (= H203)
- binding magnesium ion: S42 (≠ T54), Q81 (= Q93)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
50% identity, 61% coverage: 15:246/381 of query aligns to 3:234/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ F24), G38 (= G50), C39 (= C51), G40 (= G52), K41 (= K53), S42 (≠ T54), T43 (= T55), R128 (= R140), S134 (= S146), Q137 (= Q149)
- binding beryllium trifluoride ion: S37 (= S49), G38 (= G50), K41 (= K53), Q81 (= Q93), S134 (= S146), G136 (= G148), H191 (= H203)
- binding magnesium ion: S42 (≠ T54), Q81 (= Q93)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
50% identity, 61% coverage: 15:246/381 of query aligns to 3:234/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ F24), V17 (≠ A29), G38 (= G50), C39 (= C51), G40 (= G52), K41 (= K53), S42 (≠ T54), T43 (= T55), R128 (= R140), A132 (≠ Q144), S134 (= S146), Q137 (= Q149)
- binding tetrafluoroaluminate ion: S37 (= S49), G38 (= G50), K41 (= K53), Q81 (= Q93), S134 (= S146), G135 (= G147), G136 (= G148), E158 (= E170), H191 (= H203)
- binding magnesium ion: S42 (≠ T54), Q81 (= Q93)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
50% identity, 61% coverage: 15:246/381 of query aligns to 3:234/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ F24), V17 (≠ A29), G38 (= G50), C39 (= C51), G40 (= G52), K41 (= K53), S42 (≠ T54), T43 (= T55), R128 (= R140), A132 (≠ Q144), S134 (= S146), Q137 (= Q149)
- binding magnesium ion: S42 (≠ T54), Q81 (= Q93)
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
50% identity, 61% coverage: 15:246/381 of query aligns to 1:232/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ F24), S35 (= S49), G36 (= G50), C37 (= C51), G38 (= G52), K39 (= K53), S40 (≠ T54), T41 (= T55), R126 (= R140), A130 (≠ Q144), S132 (= S146), G134 (= G148), Q135 (= Q149)
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
44% identity, 75% coverage: 15:298/381 of query aligns to 4:288/393 of P9WQI3
- H193 (= H203) mutation to A: Decreased hydrolysis of ATP. No change in KM, but 2-fold reduction in Vmax compared to wild-type.
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
40% identity, 75% coverage: 15:301/381 of query aligns to 4:285/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
40% identity, 75% coverage: 15:301/381 of query aligns to 4:285/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
40% identity, 75% coverage: 15:301/381 of query aligns to 4:285/353 of 1oxuA
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
40% identity, 75% coverage: 15:301/381 of query aligns to 4:285/353 of Q97UY8
- S142 (= S146) mutation to A: Decrease in ATPase activity. Can form dimers.
- G144 (= G148) mutation to A: Loss of ATPase activity. Cannot form dimers. Forms an active heterodimer; when associated with A-166.
- E166 (= E170) mutation to A: Loss of ATPase activity. Can form dimers in the presence of ATP-Mg(2+). Forms an active heterodimer; when associated with A-144.; mutation to Q: Strong decrease in ATPase activity. Can form dimers in the presence of ATP alone, without Mg(2+).
Query Sequence
>CCNA_03235 FitnessBrowser__Caulo:CCNA_03235
MCRGISAMTTPKPIITFENVTKRFGKLAAVDNVSLTVNEGEFFALLGPSGCGKTTLLRML
AGFETPTEGRILIDGQDISNVPPNKRPVNMVFQSYAVFPHMTVADNVAYGLKVDNVPKAE
REARVAEALELVQLGGLGGRKPDQLSGGQRQRVALARALVKRPRVLLLDEPLSALDAKLR
EQMRTELCTLQEKVGITFIMVTHDQDEALALASRCAVMSKGLLQQVATPSDLYEFPNSRF
VADFIGQVNLFEGVLAVDEPSHAVIKSPDLPVDIFLDHGVTGPRGGTVWAAIRPEKIELH
KKADDTPPNLGDAPKGTNAVEGVIKHEAYLGGSSTYEVEIAGGRRVKVQRSNLTRWDQED
FKLGETVWLCWHACSPAVLLS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory