Comparing CCNA_03239 FitnessBrowser__Caulo:CCNA_03239 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7xjnA Structure of vcpotd1 in complex with norspermidine
34% identity, 88% coverage: 46:367/368 of query aligns to 1:321/322 of 7xjnA
Q9I6J0 Spermidine-binding periplasmic protein SpuE from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
34% identity, 88% coverage: 45:366/368 of query aligns to 24:362/365 of Q9I6J0
4eqbA 1.5 angstrom crystal structure of spermidine/putrescine abc transporter substrate-binding protein potd from streptococcus pneumoniae strain canada mdr_19a in complex with calcium and hepes
34% identity, 81% coverage: 49:345/368 of query aligns to 3:298/323 of 4eqbA
Sites not aligning to the query:
3ttnA Crystal structures of polyamine receptors spud and spue from pseudomonas aeruginosa (see paper)
34% identity, 86% coverage: 50:366/368 of query aligns to 2:335/335 of 3ttnA
P31133 Putrescine-binding periplasmic protein PotF from Escherichia coli (strain K12) (see 3 papers)
35% identity, 82% coverage: 44:343/368 of query aligns to 26:344/370 of P31133
Sites not aligning to the query:
8aszA Potf with mutations s87y and a182d in complex with agmatine
35% identity, 81% coverage: 45:343/368 of query aligns to 1:318/343 of 8aszA
P0AFK9 Spermidine/putrescine-binding periplasmic protein; SPBP from Escherichia coli (strain K12) (see 3 papers)
35% identity, 89% coverage: 41:367/368 of query aligns to 20:346/348 of P0AFK9
Sites not aligning to the query:
6ye7A E.Coli's putrescine receptor potf complexed with cadaverine (see paper)
34% identity, 81% coverage: 47:343/368 of query aligns to 1:316/341 of 6ye7A
6ye6A E.Coli's putrescine receptor potf complexed with agmatine (see paper)
34% identity, 81% coverage: 47:343/368 of query aligns to 1:316/341 of 6ye6A
Sites not aligning to the query:
6ye0B E.Coli's putrescine receptor potf complexed with putrescine (see paper)
34% identity, 81% coverage: 47:343/368 of query aligns to 1:316/341 of 6ye0B
1a99A Putrescine receptor (potf) from e. Coli (see paper)
34% identity, 81% coverage: 47:343/368 of query aligns to 1:316/341 of 1a99A
7oyxB E.Coli's putrescine receptor variant potf/d (4jdf) with mutations e39d y87s f88y s247d in complex with spermidine (see paper)
34% identity, 81% coverage: 47:343/368 of query aligns to 1:316/347 of 7oyxB
Sites not aligning to the query:
1poy1 Spermidine/putrescine-binding protein complexed with spermidine (dimer form) (see paper)
35% identity, 87% coverage: 50:368/368 of query aligns to 4:322/323 of 1poy1
Q9I6J1 Putrescine-binding periplasmic protein SpuD from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
33% identity, 85% coverage: 30:343/368 of query aligns to 10:341/367 of Q9I6J1
7oywA E.Coli's putrescine receptor variant potf/d (4jdf) with mutations e39d f88l s247d in complex with spermidine (see paper)
34% identity, 81% coverage: 47:343/368 of query aligns to 1:316/348 of 7oywA
7oyvA E.Coli's putrescine receptor variant potf/d (4jdf) with mutations e39d f88a s247d in complex with spermidine (see paper)
34% identity, 81% coverage: 47:343/368 of query aligns to 1:316/341 of 7oyvA
3ttmA Crystal structure of spud in complex with putrescine (see paper)
34% identity, 80% coverage: 50:343/368 of query aligns to 5:316/341 of 3ttmA
6hlyA Structure in p212121 form of the pbp agtb in complex with agropinic acid from a.Tumefacien r10 (see paper)
26% identity, 72% coverage: 67:332/368 of query aligns to 27:282/320 of 6hlyA
Sites not aligning to the query:
4euoA Structure of atu4243-gaba sensor (see paper)
25% identity, 77% coverage: 67:348/368 of query aligns to 23:297/313 of 4euoA
Sites not aligning to the query:
6tg2A Structure of the pbp/sbp mota in complex with mannopinic acid from a.Tumefacien r10 (see paper)
21% identity, 64% coverage: 69:302/368 of query aligns to 27:258/326 of 6tg2A
Sites not aligning to the query:
>CCNA_03239 FitnessBrowser__Caulo:CCNA_03239
MSTITQRGLNKAGLSRRSLLTATGAAAIGLTFTACGEKPKAAPGAEEAKLNFYNWDTYIG
ETTLGDFKKATGIDVNMSLFATNDELFAKLKAGNPGFDVVVPSNEFVTRMSQGGLLEPLD
HAKIPNMKNIDPSFLNPEFDPGRKFSMPYTWLLLGIGYRKSKVKGVPDSWKWLFDSDQYK
GRIALLSESADLVRLSAKYLGHSVNNIPQDMLPKIEQMLIKQKPFVKAFHDDNGQDMLMS
GEVDLVLEYNGDIAQAMKEDPDLDFVVPKEGSLINSDTLCIPKGAPRPNNAHAFINYLLD
AQAGAEISKTILYPTPNAAAKALMPEDYKNNPVIFPPADVMAKCEYGAFEGAEKASQYEE
LITRVRAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory