Comparing CCNA_03245 CCNA_03245 beta alanine-pyruvate transaminase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9A3Q9 Omega-aminotransferase; Beta-alanine--pyruvate aminotransferase; EC 2.6.1.-; EC 2.6.1.18 from Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) (see paper)
100% identity, 99% coverage: 4:442/442 of query aligns to 1:439/439 of Q9A3Q9
Q9I700 Beta-alanine--pyruvate aminotransferase; Beta-A--Py AT; Beta-alanine--pyruvate transaminase; Omega-amino acid aminotransferase; Omega-amino acid AT; Omega-amino acid--pyruvate aminotransferase; Omega-APT; EC 2.6.1.18 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
49% identity, 98% coverage: 11:441/442 of query aligns to 16:447/448 of Q9I700
4b98A The structure of the omega aminotransferase from pseudomonas aeruginosa (see paper)
49% identity, 98% coverage: 11:441/442 of query aligns to 9:440/441 of 4b98A
4uhmA Characterization of a novel transaminase from pseudomonas sp. Strain aac (see paper)
49% identity, 98% coverage: 11:441/442 of query aligns to 3:434/435 of 4uhmA
3a8uX Crystal structure of omega-amino acid:pyruvate aminotransferase
48% identity, 97% coverage: 12:441/442 of query aligns to 9:440/441 of 3a8uX
5lh9D Amine transaminase crystal structure from an uncultivated pseudomonas species in the plp-bound (internal aldimine) form
38% identity, 96% coverage: 10:434/442 of query aligns to 7:441/449 of 5lh9D
5lhaA Amine transaminase crystal structure from an uncultivated pseudomonas species in the pmp-bound form
38% identity, 96% coverage: 10:434/442 of query aligns to 5:439/447 of 5lhaA
5kr5A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
34% identity, 93% coverage: 30:441/442 of query aligns to 31:452/455 of 5kr5A
3i5tA Crystal structure of aminotransferase prk07036 from rhodobacter sphaeroides kd131
37% identity, 93% coverage: 31:441/442 of query aligns to 27:437/444 of 3i5tA
Sites not aligning to the query:
6s54A Transaminase from pseudomonas fluorescens (see paper)
34% identity, 95% coverage: 21:438/442 of query aligns to 23:448/453 of 6s54A
Sites not aligning to the query:
7qx3A Structure of the transaminase tr2e2 with eos (see paper)
34% identity, 93% coverage: 30:440/442 of query aligns to 2:416/422 of 7qx3A
5kr6B Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
33% identity, 96% coverage: 19:441/442 of query aligns to 18:456/460 of 5kr6B
5kquC Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
34% identity, 93% coverage: 30:441/442 of query aligns to 33:454/459 of 5kquC
5kr3A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
33% identity, 93% coverage: 30:441/442 of query aligns to 34:453/458 of 5kr3A
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
33% identity, 99% coverage: 6:441/442 of query aligns to 5:445/450 of 6gwiB
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
33% identity, 98% coverage: 9:441/442 of query aligns to 10:446/448 of 6io1B
7q9xAAA Probable aminotransferase
33% identity, 96% coverage: 18:442/442 of query aligns to 17:446/455 of 7q9xAAA
4a6tC Crystal structure of the omega transaminase from chromobacterium violaceum in complex with plp (see paper)
33% identity, 96% coverage: 18:442/442 of query aligns to 17:446/455 of 4a6tC
6s4gA Crystal structure of the omega transaminase from chromobacterium violaceum in complex with pmp (see paper)
33% identity, 96% coverage: 18:442/442 of query aligns to 16:445/453 of 6s4gA
6fyqA The crystal structure of a new transaminase from the marine bacterium virgibacillus (see paper)
33% identity, 98% coverage: 11:442/442 of query aligns to 7:439/443 of 6fyqA
>CCNA_03245 CCNA_03245 beta alanine-pyruvate transaminase
MLPMPDFGANDLDAFWMPFTPNRRFKRHPRMLSSASGMWYRTPESREVLDATSGLWCVNA
GHDRPKIREAIQKQAAEMDYAPCFNMGHPLAFQFASRLAQITPKGLDRIFFTNSGSESVD
TALKIALAYHRARGKGTKTRLIGRERGYHGVGFGGISVGGIPKNRMYFGSLLTGVDHLPH
THGLPGNTCAKGQPENGAHLADDLERIVALHDASNIAAVIVEPVAGSTGVLIPPKGYLER
LRAICDKHDILLIFDEVITGFGRVGAPFAAERFGVTPDLICMAKGLTNAAVPCGAVAASG
KIYDAMMDGADAPIELFHGYTYSAHPLACAAGLATLETYREDDLFARAAGLEGYWQDAMH
SLADARHVVDVRNLGLVAGIELEPRPGAPTARAMEVFETCFDEGLLIRVTGDIIALSPPL
ILEKDHIDRMVETIRRVLGQVD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory