SitesBLAST
Comparing CCNA_03279 FitnessBrowser__Caulo:CCNA_03279 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
37% identity, 69% coverage: 6:198/278 of query aligns to 3:196/248 of 6ixmC
- active site: G16 (= G19), S142 (= S144), Y155 (= Y157), K159 (= K161)
- binding nicotinamide-adenine-dinucleotide: G12 (= G15), S15 (= S18), G16 (= G19), I17 (≠ L20), D36 (= D39), I37 (= I40), A61 (≠ T64), D62 (= D65), T63 (≠ V66), N89 (= N92), A90 (= A93), M140 (≠ V142), S142 (= S144), Y155 (= Y157), K159 (= K161), P185 (= P187), A186 (≠ G188), Y187 (≠ F189), I188 (= I190), L192 (= L194)
5b4tA Crystal structure of d-3-hydroxybutyrate dehydrogenase from alcaligenes faecalis complexed with NAD+ and a substrate d-3- hydroxybutyrate (see paper)
35% identity, 69% coverage: 6:197/278 of query aligns to 2:195/260 of 5b4tA
- active site: G15 (= G19), N114 (= N116), S142 (= S144), Y155 (= Y157), K159 (= K161)
- binding (3R)-3-hydroxybutanoic acid: Q94 (≠ A96), S142 (= S144), H144 (≠ F146), K152 (≠ N154), Y155 (= Y157), W187 (≠ F189)
- binding nicotinamide-adenine-dinucleotide: G11 (= G15), T13 (≠ A17), G15 (= G19), I16 (≠ L20), F36 (≠ I40), D63 (= D65), L64 (≠ V66), N90 (= N92), G92 (= G94), L113 (≠ I115), I140 (≠ V142), Y155 (= Y157), K159 (= K161), P185 (= P187), G186 (= G188), W187 (≠ F189), V188 (≠ I190), T190 (= T192), L192 (= L194), V193 (= V195)
Sites not aligning to the query:
3w8dA Crystal structure of d-3-hydroxybutyrate dehydrogenase from alcaligenes faecalis complexed with NAD+ and an inhibitor methylmalonate
35% identity, 69% coverage: 6:197/278 of query aligns to 2:195/260 of 3w8dA
- active site: G15 (= G19), N114 (= N116), S142 (= S144), Y155 (= Y157), K159 (= K161)
- binding methylmalonic acid: Q94 (≠ A96), S142 (= S144), H144 (≠ F146), K152 (≠ N154), Y155 (= Y157), W187 (≠ F189)
- binding nicotinamide-adenine-dinucleotide: G11 (= G15), T13 (≠ A17), S14 (= S18), G15 (= G19), I16 (≠ L20), F36 (≠ I40), A62 (≠ T64), D63 (= D65), L64 (≠ V66), N90 (= N92), A91 (= A93), G92 (= G94), L113 (≠ I115), S142 (= S144), Y155 (= Y157), K159 (= K161), P185 (= P187), G186 (= G188), W187 (≠ F189), V188 (≠ I190), T190 (= T192), L192 (= L194), V193 (= V195)
Sites not aligning to the query:
3vdrA Crystal structure of d-3-hydroxybutyrate dehydrogenase, prepared in the presence of the substrate d-3-hydroxybutyrate and NAD(+) (see paper)
35% identity, 69% coverage: 6:197/278 of query aligns to 2:195/260 of 3vdrA
- active site: G15 (= G19), N114 (= N116), S142 (= S144), Y155 (= Y157), K159 (= K161)
- binding (3R)-3-hydroxybutanoic acid: Q94 (≠ A96), H144 (≠ F146), K152 (≠ N154), Y155 (= Y157), W187 (≠ F189)
- binding acetoacetic acid: Q94 (≠ A96), H144 (≠ F146), K152 (≠ N154), Y155 (= Y157), W187 (≠ F189)
- binding nicotinamide-adenine-dinucleotide: G11 (= G15), T13 (≠ A17), I16 (≠ L20), F36 (≠ I40), D63 (= D65), L64 (≠ V66), N90 (= N92), A91 (= A93), G92 (= G94), L113 (≠ I115), K159 (= K161), G186 (= G188), V188 (≠ I190), T190 (= T192), L192 (= L194), V193 (= V195)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G15), T13 (≠ A17), I16 (≠ L20), F36 (≠ I40), D63 (= D65), L64 (≠ V66), N90 (= N92), A91 (= A93), G92 (= G94), L113 (≠ I115), S142 (= S144), Y155 (= Y157), K159 (= K161), G186 (= G188), V188 (≠ I190), T190 (= T192), L192 (= L194), V193 (= V195)
Sites not aligning to the query:
3vdqA Crystal structure of alcaligenes faecalis d-3-hydroxybutyrate dehydrogenase in complex with NAD(+) and acetate (see paper)
35% identity, 69% coverage: 6:197/278 of query aligns to 2:195/260 of 3vdqA
- active site: G15 (= G19), N114 (= N116), S142 (= S144), Y155 (= Y157), K159 (= K161)
- binding acetate ion: Q94 (≠ A96), H144 (≠ F146), K152 (≠ N154), W187 (≠ F189), L192 (= L194)
- binding nicotinamide-adenine-dinucleotide: G11 (= G15), S14 (= S18), I16 (≠ L20), F36 (≠ I40), D63 (= D65), L64 (≠ V66), N90 (= N92), A91 (= A93), G92 (= G94), L113 (≠ I115), I140 (≠ V142), S142 (= S144), Y155 (= Y157), K159 (= K161), P185 (= P187), G186 (= G188), W187 (≠ F189), V188 (≠ I190), T190 (= T192), L192 (= L194), V193 (= V195)
Sites not aligning to the query:
4nbuB Crystal structure of fabg from bacillus sp (see paper)
35% identity, 78% coverage: 6:221/278 of query aligns to 5:209/244 of 4nbuB
- active site: G18 (= G19), N111 (= N116), S139 (= S144), Q149 (≠ N154), Y152 (= Y157), K156 (= K161)
- binding acetoacetyl-coenzyme a: D93 (≠ F98), K98 (≠ D103), S139 (= S144), N146 (≠ G151), V147 (≠ P152), Q149 (≠ N154), Y152 (= Y157), F184 (= F189), M189 (≠ L194), K200 (≠ N211)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G15), N17 (≠ S18), G18 (= G19), I19 (≠ L20), D38 (= D39), F39 (≠ I40), V59 (≠ T64), D60 (= D65), V61 (= V66), N87 (= N92), A88 (= A93), G89 (= G94), I90 (= I95), T137 (≠ V142), S139 (= S144), Y152 (= Y157), K156 (= K161), P182 (= P187), F184 (= F189), T185 (≠ I190), T187 (= T192), M189 (≠ L194)
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
33% identity, 77% coverage: 9:221/278 of query aligns to 7:224/260 of 6zzqA
- active site: G17 (= G19), S142 (= S144), Y155 (= Y157)
- binding acetoacetic acid: Q94 (≠ A96), S142 (= S144), K152 (≠ N154), Y155 (= Y157), Q196 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: G13 (= G15), S16 (= S18), G17 (= G19), I18 (≠ L20), D37 (= D39), M38 (≠ I40), D63 (= D65), V64 (= V66), N90 (= N92), A91 (= A93), G92 (= G94), M140 (≠ V142), A141 (= A143), S142 (= S144), Y155 (= Y157), K159 (= K161), Y187 (≠ F189), V188 (≠ I190), T190 (= T192)
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
33% identity, 77% coverage: 9:221/278 of query aligns to 8:225/261 of 6zzsD
- active site: G18 (= G19), S143 (= S144), Y156 (= Y157)
- binding nicotinamide-adenine-dinucleotide: G14 (= G15), S17 (= S18), I19 (≠ L20), D38 (= D39), M39 (≠ I40), D64 (= D65), V65 (= V66), N91 (= N92), A92 (= A93), G93 (= G94), M141 (≠ V142), A142 (= A143), S143 (= S144), Y156 (= Y157), K160 (= K161), P186 (= P187), G187 (= G188), V189 (≠ I190), T191 (= T192), L193 (= L194)
- binding 3-oxidanylidenepentanoic acid: Q95 (≠ A96), S143 (= S144), N145 (≠ F146), K153 (≠ N154), Y156 (= Y157), Q197 (vs. gap)
2ztlA Closed conformation of d-3-hydroxybutyrate dehydrogenase complexed with NAD+ and l-3-hydroxybutyrate (see paper)
36% identity, 69% coverage: 6:197/278 of query aligns to 2:195/260 of 2ztlA
- active site: G15 (= G19), N114 (= N116), S142 (= S144), Y155 (= Y157), K159 (= K161)
- binding (3s)-3-hydroxybutanoic acid: Q94 (≠ A96), S142 (= S144), H144 (≠ F146), K152 (≠ N154), Y155 (= Y157)
- binding nicotinamide-adenine-dinucleotide: G11 (= G15), G15 (= G19), I16 (≠ L20), F36 (= F42), L64 (≠ V66), N90 (= N92), A91 (= A93), G92 (= G94), L113 (≠ I115), Y155 (= Y157), K159 (= K161), P185 (= P187), W187 (≠ F189), V188 (≠ I190), T190 (= T192), V193 (= V195)
Sites not aligning to the query:
1wmbA Crystal structure of NAD dependent d-3-hydroxybutylate dehydrogenase (see paper)
36% identity, 69% coverage: 6:197/278 of query aligns to 2:195/260 of 1wmbA
Sites not aligning to the query:
8cxaA Crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from mycobacterium smegmatis with bound NAD
36% identity, 67% coverage: 8:194/278 of query aligns to 5:194/251 of 8cxaA
- binding nicotinamide-adenine-dinucleotide: G12 (= G15), Q15 (≠ S18), G16 (= G19), I17 (≠ L20), D36 (= D39), V63 (= V66), N89 (= N92), A91 (= A96), S94 (≠ G99), I142 (≠ V142), S143 (≠ A143), S144 (= S144), Y157 (= Y157), K161 (= K161), P187 (= P187), H188 (≠ G188), I190 (= I190), I194 (≠ L194)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
35% identity, 76% coverage: 5:214/278 of query aligns to 2:210/247 of 4jroC
- active site: G16 (= G19), S142 (= S144), Q152 (≠ N154), Y155 (= Y157), K159 (= K161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G15), S14 (≠ A17), R15 (≠ S18), G16 (= G19), I17 (≠ L20), N35 (≠ A38), Y36 (≠ D39), N37 (≠ I40), G38 (≠ N41), S39 (≠ F42), N63 (≠ D65), V64 (= V66), N90 (= N92), A91 (= A93), I93 (= I95), I113 (= I115), S142 (= S144), Y155 (= Y157), K159 (= K161), P185 (= P187), I188 (= I190), T190 (= T192)
2dtxA Structure of thermoplasma acidophilum aldohexose dehydrogenase (aldt) in complex with d-mannose (see paper)
36% identity, 68% coverage: 6:195/278 of query aligns to 5:182/255 of 2dtxA
2dteA Structure of thermoplasma acidophilum aldohexose dehydrogenase (aldt) in complex with nadh (see paper)
36% identity, 68% coverage: 6:195/278 of query aligns to 5:182/255 of 2dteA
- active site: G18 (= G19), S132 (= S144), Y145 (= Y157), S148 (= S160), K149 (= K161)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G15), S16 (≠ A17), M17 (≠ S18), G18 (= G19), I19 (≠ L20), S38 (≠ D39), I39 (= I40), C52 (≠ T64), D53 (= D65), V54 (= V66), N80 (= N92), A81 (= A93), I130 (≠ V142), S132 (= S144), Y145 (= Y157), K149 (= K161), P174 (= P187), A175 (≠ G188), T176 (≠ F189), I177 (= I190), T179 (= T192), P180 (= P193), L181 (= L194), V182 (= V195)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
33% identity, 74% coverage: 9:215/278 of query aligns to 5:210/246 of 3osuA
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
33% identity, 74% coverage: 9:215/278 of query aligns to 2:203/239 of 3sj7A
- active site: G12 (= G19), S138 (= S144), Q148 (≠ N154), Y151 (= Y157), K155 (= K161)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G15), S10 (≠ A17), R11 (≠ S18), I13 (≠ L20), N31 (= N41), Y32 (≠ F42), A33 (≠ P43), G34 (≠ A44), S35 (≠ A45), A58 (≠ T64), N59 (≠ D65), V60 (= V66), N86 (= N92), A87 (= A93), T109 (≠ I115), S138 (= S144), Y151 (= Y157), K155 (= K161), P181 (= P187), G182 (= G188)
8g9vE Crystal structures of 17-beta-hydroxysteroid dehydrogenase 13 (see paper)
28% identity, 88% coverage: 9:254/278 of query aligns to 37:274/293 of 8g9vE
- binding nicotinamide-adenine-dinucleotide: G43 (= G15), H46 (≠ S18), G47 (= G19), I48 (≠ L20), D67 (= D39), I68 (= I40), D93 (= D65), C94 (≠ V66), N120 (= N92), A121 (= A93), G122 (= G94), V170 (= V142), S172 (= S144), Y185 (= Y157), K189 (= K161), P218 (= P187), F220 (= F189), V221 (≠ I190), T223 (= T192), F225 (≠ L194)
- binding 4-{[2,5-dimethyl-3-(4-methylbenzene-1-sulfonyl)benzene-1-sulfonyl]amino}benzoic acid: S172 (= S144), V173 (≠ G145), C174 (≠ F146), I179 (≠ G151), Y185 (= Y157), V219 (≠ G188), F220 (= F189), F225 (≠ L194), W234 (≠ A210), F266 (≠ L246)
1x1tA Crystal structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas fragi complexed with NAD+ (see paper)
33% identity, 81% coverage: 6:231/278 of query aligns to 2:228/236 of 1x1tA
- active site: G15 (= G19), N114 (= N116), S142 (= S144), Y155 (= Y157), K159 (= K161)
- binding cacodylate ion: S142 (= S144), H144 (≠ F146), Y155 (= Y157), W187 (≠ F189)
- binding nicotinamide-adenine-dinucleotide: G11 (= G15), T13 (≠ A17), S14 (= S18), G15 (= G19), I16 (≠ L20), G35 (≠ N41), F36 (= F42), D63 (= D65), L64 (≠ V66), N90 (= N92), G92 (= G94), L113 (≠ I115), S142 (= S144), Y155 (= Y157), K159 (= K161), P185 (= P187), W187 (≠ F189), V188 (≠ I190), T190 (= T192)
Sites not aligning to the query:
1zemA Crystal structure of NAD+-bound xylitol dehydrogenase (see paper)
35% identity, 67% coverage: 6:190/278 of query aligns to 3:188/260 of 1zemA
- active site: N16 (≠ G19), S142 (= S144), Y155 (= Y157), K159 (= K161)
- binding nicotinamide-adenine-dinucleotide: G12 (= G15), G15 (≠ S18), N16 (≠ G19), I17 (≠ L20), D36 (= D39), M37 (≠ I40), D62 (= D65), V63 (= V66), N89 (= N92), A90 (= A93), G91 (= G94), T140 (≠ V142), S142 (= S144), Y155 (= Y157), K159 (= K161), P185 (= P187), M188 (≠ I190)
Sites not aligning to the query:
Q7Z5P4 17-beta-hydroxysteroid dehydrogenase 13; 17-beta-HSD 13; Hepatic retinol/retinal dehydrogenase; Short chain dehydrogenase/reductase family 16C member 3; Short-chain dehydrogenase/reductase 9; EC 1.1.1.-; EC 1.1.1.62; EC 1.1.1.105 from Homo sapiens (Human) (see 2 papers)
28% identity, 88% coverage: 9:254/278 of query aligns to 37:274/300 of Q7Z5P4
- GIG 47:49 (≠ GLG 19:21) mutation to AIA: Loss of retinol/retinal dehydrogenase activity.
- 69:84 (vs. 41:56, 38% identical) mutation Missing: Does not localize to lipid droplets.
- 85:93 (vs. 57:65, 44% identical) mutation Missing: Does not localize to lipid droplets.
- 94:106 (vs. 66:78, 8% identical) mutation Missing: Does not localize to lipid droplets.
- R97 (≠ S69) mutation to A: Decreased retinol/retinal dehydrogenase activity; when associated with A-101.
- Y101 (≠ R73) mutation to A: Decreased retinol/retinal dehydrogenase activity; when associated with A-97.
- N144 (= N116) mutation to A: Loss of retinol/retinal dehydrogenase activity.
- K153 (≠ H125) mutation to A: Loss of retinol/retinal dehydrogenase activity; when associated with A-156.
- L156 (≠ Y128) mutation to A: Loss of retinol/retinal dehydrogenase activity; when associated with A-153.
- S172 (= S144) mutation to A: Loss of retinol/retinal dehydrogenase activity.
- Y185 (= Y157) mutation to A: Loss of retinol/retinal dehydrogenase activity; when associated with A-189.
- K189 (= K161) mutation to A: Loss of retinol/retinal dehydrogenase activity; when associated with A-185.
- L199 (= L171) mutation to A: Loss of retinol/retinal dehydrogenase activity; when associated with A-202.
- E202 (= E174) mutation to A: Loss of retinol/retinal dehydrogenase activity; when associated with A-199.
- K208 (vs. gap) mutation to A: Decreased retinol/retinal dehydrogenase activity.
- P260 (= P240) to S: loss of retinol/retinal dehydrogenase activity; does not affect localization to lipid droplets; dbSNP:rs62305723
Sites not aligning to the query:
- 22:28 mutation Missing: Does not localize to lipid droplets.
Query Sequence
>CCNA_03279 FitnessBrowser__Caulo:CCNA_03279
MAKNPFQDKVCIVTGAASGLGRALSAQLAEAGATLIIADINFPAAEELAHRMNQLGVTAK
PVRTDVTLSESVRQLIEGTAAEFGRIDYLFNNAGIAVFGEIRDLSLDHWRRVIDINLMGE
IYGIHYAYPQMIKQGFGHIVNVASGFGMAPGPVNSPYVASKFAVFGLSHALATEARAFGV
HVTVACPGFIKTPLVDNIHCVNAAPADVLANIPVAMVPVDRAANIILTGVAKRKMVIAFP
GYVGVLAFIHRFLPAVWDSMGKGEIARFRKIRKDPAVS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory