SitesBLAST
Comparing CCNA_03293 FitnessBrowser__Caulo:CCNA_03293 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6iunB Crystal structure of enoyl-coa hydratase (ech) from ralstonia eutropha h16 in complex with NAD
52% identity, 98% coverage: 14:693/696 of query aligns to 4:690/692 of 6iunB
- active site: A60 (= A70), F65 (= F75), E73 (≠ G81), H77 (≠ Q85), G101 (= G109), E104 (= E112), E124 (= E132), G132 (= G140), K248 (= K261), S407 (= S420), H428 (= H441), E440 (= E453), N478 (= N491)
- binding nicotinamide-adenine-dinucleotide: G300 (= G313), T301 (= T314), M302 (= M315), E321 (= E334), T322 (≠ A335), Y365 (≠ M378), A377 (= A390), V378 (= V391), E380 (= E393), V384 (≠ I397), V388 (= V401), N405 (= N418), S407 (= S420)
3zwaA Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 3s-hydroxy-hexanoyl-coa (see paper)
43% identity, 97% coverage: 19:690/696 of query aligns to 16:710/727 of 3zwaA
- active site: A67 (= A70), F72 (= F75), G82 (≠ Q85), G106 (= G109), E109 (= E112), P128 (= P131), E129 (= E132), P136 (= P139), G137 (= G140), K255 (= K261), S416 (= S420), H437 (= H441), E449 (= E453), N487 (= N491)
- binding (S)-3-Hydroxyhexanoyl-CoA: V27 (= V30), A65 (= A68), G66 (= G69), A67 (= A70), D68 (= D71), I69 (= I72), L104 (= L107), E109 (= E112), R124 (≠ K127), E129 (= E132), L132 (≠ I135), G137 (= G140), Y162 (≠ H165)
5omoA Crystal structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with with 3s-hydroxy-decanoyl-coa and 3-keto- decanoyl-coa
43% identity, 97% coverage: 19:690/696 of query aligns to 15:709/725 of 5omoA
- active site: A66 (= A70), F71 (= F75), G81 (≠ Q85), G105 (= G109), E108 (= E112), P127 (= P131), E128 (= E132), P135 (= P139), G136 (= G140), K254 (= K261), S415 (= S420), H436 (= H441), E448 (= E453), N486 (= N491)
- binding (s)-3-hydroxydecanoyl-coa: P25 (= P29), V26 (= V30), A28 (= A32), P31 (≠ A35), A64 (= A68), A66 (= A70), D67 (= D71), I68 (= I72), L103 (= L107), G105 (= G109), E108 (= E112), P127 (= P131), E128 (= E132), Y161 (≠ H165), F260 (= F267), K280 (≠ R287)
- binding 3-keto-decanoyl-coa: S415 (= S420), N486 (= N491), K519 (≠ P524), M520 (= M525), V525 (≠ M530), Y658 (= Y641)
5mgbA Crystal structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with acetoacetyl-coa and NAD (see paper)
43% identity, 97% coverage: 19:690/696 of query aligns to 15:709/725 of 5mgbA
- active site: A66 (= A70), F71 (= F75), G81 (≠ Q85), G105 (= G109), E108 (= E112), P127 (= P131), E128 (= E132), P135 (= P139), G136 (= G140), K254 (= K261), S415 (= S420), H436 (= H441), E448 (= E453), N486 (= N491)
- binding acetoacetyl-coenzyme a: P25 (= P29), V26 (= V30), A64 (= A68), G65 (= G69), A66 (= A70), D67 (= D71), I68 (= I72), G105 (= G109), E128 (= E132), Y161 (≠ H165)
- binding nicotinamide-adenine-dinucleotide: L307 (≠ I310), G308 (= G311), G310 (= G313), T311 (= T314), M312 (= M315), E331 (= E334), S332 (≠ A335), Q336 (≠ N339), V386 (= V391), F387 (= F392), E388 (= E393), N413 (= N418), S415 (= S420), H436 (= H441)
3zwcA Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 3s-hydroxy-decanoyl-coa (see paper)
43% identity, 97% coverage: 19:690/696 of query aligns to 15:709/725 of 3zwcA
- active site: A66 (= A70), F71 (= F75), G81 (≠ Q85), G105 (= G109), E108 (= E112), P127 (= P131), E128 (= E132), P135 (= P139), G136 (= G140), K254 (= K261), S415 (= S420), H436 (= H441), E448 (= E453), N486 (= N491)
- binding (s)-3-hydroxydecanoyl-coa: V26 (= V30), A64 (= A68), G65 (= G69), A66 (= A70), D67 (= D71), I68 (= I72), G77 (= G81), L78 (≠ P82), L80 (= L84), V101 (≠ T105), G104 (= G108), G105 (= G109), E108 (= E112), E128 (= E132), F260 (= F267)
- binding nicotinamide-adenine-dinucleotide: G308 (= G311), G310 (= G313), T311 (= T314), M312 (= M315), E331 (= E334), Q336 (≠ N339), A385 (= A390), V386 (= V391), F387 (= F392), E388 (= E393), K393 (= K398), N413 (= N418), S415 (= S420), H436 (= H441)
2x58A The crystal structure of mfe1 liganded with coa (see paper)
43% identity, 97% coverage: 19:690/696 of query aligns to 15:709/725 of 2x58A
- active site: A66 (= A70), F71 (= F75), G81 (≠ Q85), G105 (= G109), E108 (= E112), P127 (= P131), E128 (= E132), P135 (= P139), G136 (= G140), K254 (= K261), S415 (= S420), H436 (= H441), E448 (= E453), N486 (= N491)
- binding adenosine-5'-diphosphate: G310 (= G313), T311 (= T314), M312 (= M315), E331 (= E334), S332 (≠ A335), Q336 (≠ N339), V386 (= V391), L392 (≠ I397)
- binding coenzyme a: V26 (= V30), A28 (= A32), A64 (= A68), A66 (= A70), D67 (= D71), I68 (= I72), E128 (= E132)
3zw9A Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with (2s,3s)-3-hydroxy-2- methylbutanoyl-coa (see paper)
43% identity, 97% coverage: 19:690/696 of query aligns to 13:707/723 of 3zw9A
- active site: A64 (= A70), F69 (= F75), G79 (≠ Q85), G103 (= G109), E106 (= E112), P125 (= P131), E126 (= E132), P133 (= P139), G134 (= G140), K252 (= K261), S413 (= S420), H434 (= H441), E446 (= E453), N484 (= N491)
- binding nicotinamide-adenine-dinucleotide: L305 (≠ I310), G306 (= G311), G308 (= G313), T309 (= T314), M310 (= M315), E329 (= E334), Q334 (≠ N339), A383 (= A390), V384 (= V391), F385 (= F392), E386 (= E393), N411 (= N418), S413 (= S420), H434 (= H441)
- binding (2s,3s)-3-hydroxy-2-methylbutanoyl-coa: V24 (= V30), A62 (= A68), G63 (= G69), A64 (= A70), I66 (= I72), G102 (= G108), G103 (= G109), E106 (= E112), E126 (= E132), P133 (= P139), Y159 (≠ H165)
6zicAAA structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with 3s-hydroxybutanoyl-coa and nadh'
43% identity, 97% coverage: 19:690/696 of query aligns to 15:707/723 of 6zicAAA
- active site: A66 (= A70), F71 (= F75), G81 (≠ Q85), G105 (= G109), E108 (= E112), P127 (= P131), E128 (= E132), G136 (= G140), K254 (= K261), S413 (= S420), H434 (= H441), E446 (= E453), N484 (= N491)
- binding 3-hydroxybutanoyl-coenzyme a: P25 (= P29), V26 (= V30), A28 (= A32), A66 (= A70), D67 (= D71), I68 (= I72), G104 (= G108), G105 (= G109), E108 (= E112), E128 (= E132), Y161 (≠ H165)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G308 (= G311), G310 (= G313), T311 (= T314), M312 (= M315), E331 (= E334), S332 (≠ A335), Q336 (≠ N339), A383 (= A390), V384 (= V391), F385 (= F392), E386 (= E393), L390 (≠ I397), K391 (= K398), N411 (= N418), S413 (= S420), H434 (= H441)
6zibAAA structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with acetoacetyl-coa and nadh'
43% identity, 97% coverage: 19:690/696 of query aligns to 15:707/723 of 6zibAAA
- active site: A66 (= A70), F71 (= F75), G81 (≠ Q85), G105 (= G109), E108 (= E112), P127 (= P131), E128 (= E132), G136 (= G140), K254 (= K261), S413 (= S420), H434 (= H441), E446 (= E453), N484 (= N491)
- binding acetoacetyl-coenzyme a: P25 (= P29), V26 (= V30), A64 (= A68), G65 (= G69), A66 (= A70), D67 (= D71), I68 (= I72), G104 (= G108), G105 (= G109), E128 (= E132), Y161 (≠ H165)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G310 (= G313), T311 (= T314), M312 (= M315), E331 (= E334), S332 (≠ A335), Q336 (≠ N339), A383 (= A390), V384 (= V391), F385 (= F392), E386 (= E393), N411 (= N418), H434 (= H441)
6z5oAAA Peroxisomal bifunctional enzyme (see paper)
43% identity, 97% coverage: 19:690/696 of query aligns to 16:703/716 of 6z5oAAA
- active site: A67 (= A70), F72 (= F75), G82 (≠ Q85), G106 (= G109), E109 (= E112), P128 (= P131), E129 (= E132), G137 (= G140), K255 (= K261), S409 (= S420), H430 (= H441), E442 (= E453), N480 (= N491)
- binding coenzyme a: P26 (= P29), V27 (= V30), A65 (= A68), D68 (= D71), I69 (= I72), P128 (= P131), Y162 (≠ H165), F277 (= F283), K281 (≠ R287)
- binding nicotinamide-adenine-dinucleotide: G309 (= G311), G311 (= G313), T312 (= T314), M313 (= M315), E332 (= E334), S333 (≠ A335), Q337 (≠ N339), A379 (= A390), V380 (= V391), F381 (= F392), E382 (= E393), K387 (= K398), N407 (= N418), S409 (= S420), H430 (= H441)
- binding nicotinamide: A67 (= A70), E109 (= E112), E129 (= E132), P136 (= P139), F261 (= F267)
3zwbA Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 2trans-hexenoyl-coa (see paper)
43% identity, 97% coverage: 19:690/696 of query aligns to 15:709/725 of 3zwbA
- active site: A66 (= A70), G81 (≠ Q85), G105 (= G109), E108 (= E112), P127 (= P131), A128 (≠ E132), P135 (= P139), G136 (= G140), S415 (= S420), H436 (= H441), E448 (= E453), N486 (= N491)
- binding (2E)-Hexenoyl-CoA: P25 (= P29), V26 (= V30), A28 (= A32), A64 (= A68), G65 (= G69), A66 (= A70), D67 (= D71), I68 (= I72), V101 (≠ T105), L103 (= L107), G105 (= G109), E108 (= E112), G136 (= G140), Y161 (≠ H165), K280 (≠ R287)
Q08426 Peroxisomal bifunctional enzyme; PBE; PBFE; L-bifunctional protein; LBP; Multifunctional enzyme 1; MFE1; EC 4.2.1.17; EC 5.3.3.8; EC 1.1.1.35 from Homo sapiens (Human) (see 5 papers)
41% identity, 96% coverage: 20:690/696 of query aligns to 11:705/723 of Q08426
- V40 (≠ I49) to G: in dbSNP:rs1062551
- I41 (≠ A50) to R: in dbSNP:rs1062552
- T75 (≠ S83) to I: in dbSNP:rs1062553
- K165 (≠ A173) modified: N6-acetyllysine; alternate; mutation to Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-171; Q-346 and Q-584.
- K171 (≠ E179) modified: N6-acetyllysine; mutation to Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-165; Q-346 and Q-584.
- A274 (= A285) to T: in dbSNP:rs2302819
- A325 (≠ I332) to G: in dbSNP:rs1062555
- K346 (≠ N353) modified: N6-acetyllysine; mutation to Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-165; Q-171 and Q-584.
- K584 (≠ E573) modified: N6-acetyllysine; alternate; mutation to Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-165; Q-171 and Q-346.
- K598 (≠ E585) to T: in dbSNP:rs1042437
- T606 (≠ K593) to P: in dbSNP:rs1042438
Sites not aligning to the query:
- 3 E → K: in FRTS3; the mutant is mistargeted to mitochondria; results in impaired mitochondrial oxidative phosphorylation and defects in the transport of fluids across the epithelium of renal proximal tubular cells; dbSNP:rs398124646
6yswA E. Coli anaerobic trifunctional enzyme subunit-alpha in complex with coenzyme a
34% identity, 97% coverage: 19:693/696 of query aligns to 12:702/707 of 6yswA
- active site: A66 (= A70), I71 (≠ F75), A84 (vs. gap), Q88 (= Q85), G112 (= G109), E115 (= E112), P136 (= P131), E137 (= E132), G145 (= G140), D264 (≠ K261), S422 (= S420), H443 (= H441), E455 (= E453), N493 (= N491)
- binding coenzyme a: E23 (vs. gap), M25 (≠ V30), A66 (= A70), D67 (= D71), I68 (= I72), P136 (= P131), E137 (= E132), L140 (≠ I135), T290 (≠ R287), K293 (≠ A290)
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
33% identity, 96% coverage: 13:683/696 of query aligns to 42:750/763 of P40939
- V282 (≠ F227) to D: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852773
- I305 (= I245) to N: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852774
- L342 (≠ V282) to P: in LCHAD deficiency; dbSNP:rs137852772
- E510 (= E453) active site, For hydroxyacyl-coenzyme A dehydrogenase activity; to Q: in AFLP and LCHAD deficiency; loss of long-chain-3-hydroxyacyl-CoA dehydrogenase activity; dbSNP:rs137852769
1wdlA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form ii (native4) (see paper)
32% identity, 96% coverage: 25:693/696 of query aligns to 24:713/715 of 1wdlA
- active site: A69 (= A70), N89 (≠ V90), N93 (≠ S94), G117 (= G109), E120 (= E112), P139 (= P131), E140 (= E132), P147 (= P139), G148 (= G140), S430 (= S420), H451 (= H441), E463 (= E453), N501 (= N491)
- binding nicotinamide-adenine-dinucleotide: A322 (= A312), I324 (≠ T314), M325 (= M315), D344 (≠ E334), I345 (≠ A335), A400 (= A390), V401 (= V391), E403 (= E393), N428 (= N418), T429 (= T419), S430 (= S420)
P28793 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Pseudomonas fragi (see paper)
32% identity, 96% coverage: 25:693/696 of query aligns to 24:713/715 of P28793
1wdmA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form i (native3) (see paper)
32% identity, 96% coverage: 25:693/696 of query aligns to 24:705/707 of 1wdmA
- active site: A69 (= A70), N89 (≠ V90), N93 (≠ S94), G117 (= G109), E120 (= E112), P139 (= P131), E140 (= E132), P147 (= P139), G148 (= G140), S430 (= S420), H451 (= H441), E463 (= E453), N501 (= N491)
- binding acetyl coenzyme *a: K142 (≠ N134), D297 (≠ E286), M459 (= M449), N501 (= N491), P534 (= P524), Y652 (≠ N639), L658 (≠ V645)
- binding nicotinamide-adenine-dinucleotide: G321 (= G311), A322 (= A312), I324 (≠ T314), M325 (= M315), D344 (≠ E334), V401 (= V391), E403 (= E393), N428 (= N418), S430 (= S420), N454 (≠ S444)
6tnmA E. Coli aerobic trifunctional enzyme subunit-alpha (see paper)
31% identity, 94% coverage: 16:670/696 of query aligns to 13:691/719 of 6tnmA
- active site: A68 (= A70), F73 (= F75), G116 (= G109), E119 (= E112), P138 (= P131), E139 (= E132), G147 (= G140), N271 (≠ K261), S429 (= S420), H450 (= H441), E462 (= E453), N500 (= N491)
- binding adenosine-5'-triphosphate: D343 (≠ E334), I344 (≠ A335), V400 (= V391), V401 (≠ F392), V406 (≠ I397), K584 (= K563)
P21177 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Escherichia coli (strain K12) (see 2 papers)
31% identity, 94% coverage: 16:670/696 of query aligns to 13:691/729 of P21177
- G116 (= G109) mutation to F: Absence of both enoyl-CoA hydratase and 3-hydroxyacyl-CoA epimerase activities. Delta(3)-cis-Delta(2)-trans-enoyl-CoA isomerase is only slightly affected.
- G322 (= G313) mutation to A: 10-fold increase in KM for NADH.
- H450 (= H441) active site, For 3-hydroxyacyl-CoA dehydrogenase activity; mutation H->A,Q: Almost complete loss of 3-hydroxyacyl-CoA dehydrogenase activity.
7o4uA Structure of the alpha subunit of mycobacterium tuberculosis beta- oxidation trifunctional enzyme in complex with oxidized nicotinamide adenine dinucleotide (see paper)
30% identity, 95% coverage: 21:679/696 of query aligns to 12:705/711 of 7o4uA
Query Sequence
>CCNA_03293 FitnessBrowser__Caulo:CCNA_03293
MEAAMAAINAVTDFSVEGDIGVVTLNSPPVNALSAAVREGLQGAFDAAIADAAVKAIVLI
CDGKTFIAGADITEFGKAMTGPSLQDVQNVIENSPKPVIAAIHGTALGGGLEVALVANYR
VAVPSAKAGLPEVNIGLLPGAGGTQRLPRIVGVEKALEMVTTGQHVPAKAAHAMGLFDEL
VEEGKLREGAIAFAKAVVAENRPLKKVRDLNEKVEAARGKPEIFEAFRKANAKKFRGFMA
PENNIKCIEAAVNLPFDEGLKAERKLFMELMTGSQSAAQRYVFFAERQAAKIPDVPDDTP
TIPVKKVGVIGAGTMGGGIAMNFLNAGIPVTIIEAKQENLERGVGIIRKNYENTAKKGRL
TQDDVEKRMALLTPSMEMEALADCDMIIEAVFELMEIKKEVFTKLDKIAKPGAILATNTS
YLDVDAIAAVTSRPESVIGTHFFSPANVMRLLELVRGDKTSKDVIATCMKLSKTIGKVPV
LVGVCYGFVGNRMLAQRQREAQKLILEGAMPWDVDRVLYDFGLPMGPFAMSDLAGLDIGW
DPAKTSSSTVREVLCEMDRRGQKNGKGFYDYDENRNAKPSPVVEEVIRDFAEKRQIQRRE
ITDQEILERCLYPMVNEGAKILEEGKAIRASDIDIVWINGYGWPVYSGGPMFWGELVGLD
KVLAKMKQFHAELGDDFKPSALLERLVAEGKGFKDA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory