Comparing CCNA_03309 FitnessBrowser__Caulo:CCNA_03309 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
2vavB Crystal structure of deacetylcephalosporin c acetyltransferase (dac- soak) (see paper)
25% identity, 88% coverage: 15:330/358 of query aligns to 6:323/350 of 2vavB
Sites not aligning to the query:
2vatA Crystal structure of deacetylcephalosporin c acetyltransferase in complex with coenzyme a (see paper)
25% identity, 88% coverage: 15:330/358 of query aligns to 5:321/347 of 2vatA
Sites not aligning to the query:
P45131 Homoserine O-acetyltransferase; HAT; Homoserine O-trans-acetylase; Homoserine transacetylase; HTA; EC 2.3.1.31 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
26% identity, 71% coverage: 40:293/358 of query aligns to 14:285/358 of P45131
Sites not aligning to the query:
D2Z028 L-serine/homoserine O-acetyltransferase; Homoserine O-trans-acetylase; EC 2.3.1.30; EC 2.3.1.31 from Streptomyces lavendulae (see paper)
30% identity, 49% coverage: 43:219/358 of query aligns to 21:204/374 of D2Z028
6puxA Homoserine transacetylase metx from mycobacterium tuberculosis (see paper)
25% identity, 71% coverage: 70:323/358 of query aligns to 45:330/366 of 6puxA
8f2lA Crystal structure of mycobacterium tuberculosis homoserine transacetylase in complex with l-homoserine (see paper)
25% identity, 71% coverage: 70:323/358 of query aligns to 44:329/367 of 8f2lA
7rytB Crystal structure of mycobacterium tuberculosis acetylated homoserine transacetylase with coenzyme a (see paper)
25% identity, 71% coverage: 70:323/358 of query aligns to 44:329/368 of 7rytB
Sites not aligning to the query:
Q10341 Serine O-succinyltransferase; SST; EC 2.3.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
25% identity, 71% coverage: 10:262/358 of query aligns to 54:320/504 of Q10341
Sites not aligning to the query:
Q6FEQ3 Homoserine O-succinyltransferase; HST; Homoserine transsuccinylase; HTS; EC 2.3.1.46 from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) (see paper)
29% identity, 35% coverage: 93:219/358 of query aligns to 78:211/387 of Q6FEQ3
Sites not aligning to the query:
5w8oB Homoserine transacetylase metx from mycobacterium hassiacum (see paper)
25% identity, 72% coverage: 70:328/358 of query aligns to 35:318/346 of 5w8oB
>CCNA_03309 FitnessBrowser__Caulo:CCNA_03309
MIRALLAALALSAAASITVPDAARAAPWPTTEGDLVFKDVTFKSGERLSEARMRYTTAGT
PHRNAQGEIDNAVMLLHGTGGSGKNFLSPLFADELFGPGQPLDLAKTYVIMPDNIGHGGS
SKPSDGLRMAFPRYDYDDMIALQHRLLVEGLGVKRLKLILGTSMGCMHAFVWGQTYPGFA
ERLAPFACNAVPLVGRNRMWRKMAMDAIRADPAWKEGNYTTQPMAGLRTLTDLLILAGAN
PLAQQAQYPTREATDKALDQAFNARIGTIDANDALYYIDASRTYDPSPGLEKITVPVLWV
NSADDFINPPELGLAEPLAKRMPKARFVLIPASTETRGHGTHTAAKFWKADLAKLLAQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory