SitesBLAST
Comparing CCNA_03491 CCNA_03491 gluconate 5-dehydrogenase (Ga5DH)-related protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
38% identity, 97% coverage: 6:258/260 of query aligns to 2:250/252 of 1vl8B
- active site: G17 (= G21), S143 (= S152), I154 (vs. gap), Y157 (= Y165), K161 (= K169)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G17), R16 (= R20), G17 (= G21), L18 (≠ I22), S37 (≠ G41), R38 (≠ S42), C63 (≠ V66), D64 (= D67), V65 (= V68), A91 (≠ N94), A92 (= A95), G93 (= G96), I94 (= I97), V114 (= V118), I141 (≠ V150), S143 (= S152), Y157 (= Y165), K161 (= K169), P187 (= P195), G188 (= G196), Y190 (≠ I198), T192 (= T200), M194 (= M202), T195 (= T203)
4za2D Crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d- gluconate dehydrogenase complexed with NAD+ (see paper)
37% identity, 99% coverage: 1:257/260 of query aligns to 1:244/247 of 4za2D
- binding nicotinamide-adenine-dinucleotide: G17 (= G17), D19 (≠ N19), L22 (≠ I22), I42 (≠ P44), D65 (= D67), M66 (≠ V68), N92 (= N94), A93 (= A95), G94 (= G96), L115 (≠ V118), I143 (≠ V150), S145 (= S152), Y158 (= Y165), K162 (= K169), G189 (= G196), M191 (≠ I198), T193 (= T200), N195 (≠ M202)
5u9pB Crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with NADP and tartrate
36% identity, 97% coverage: 6:258/260 of query aligns to 12:258/261 of 5u9pB
- active site: G27 (= G21), S152 (= S152), Y165 (= Y165), K169 (= K169)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G23 (= G17), R26 (= R20), G27 (= G21), I28 (= I22), R48 (≠ S42), D73 (= D67), V74 (= V68), N100 (= N94), A101 (= A95), I150 (≠ V150), Y165 (= Y165), K169 (= K169), P195 (= P195), F198 (≠ I198), T200 (= T200), L202 (≠ M202), N203 (≠ T203)
7do7A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NAD and l-rhamnose bound-form) (see paper)
37% identity, 97% coverage: 8:259/260 of query aligns to 3:253/256 of 7do7A
- active site: G16 (= G21), S146 (= S152), Y159 (= Y165)
- binding nicotinamide-adenine-dinucleotide: G12 (= G17), R15 (= R20), G16 (= G21), I17 (= I22), S37 (= S42), D66 (= D67), A67 (≠ V68), N93 (= N94), A94 (= A95), G95 (= G96), I96 (= I97), V144 (= V150), S145 (≠ A151), S146 (= S152), Y159 (= Y165), K163 (= K169), P189 (= P195), G190 (= G196), I192 (= I198), T194 (= T200), I196 (≠ M202)
- binding beta-L-rhamnopyranose: F99 (vs. gap), S146 (= S152), S148 (≠ A154), Q156 (≠ N162), Y159 (= Y165), N197 (≠ T203), D235 (= D241), M236 (≠ A242), R238 (≠ S244)
7b81A Crystal structure of azotobacter vinelandii l-rhamnose 1-dehydrogenase (NAD bound-form) (see paper)
37% identity, 97% coverage: 8:259/260 of query aligns to 3:253/256 of 7b81A
- active site: G16 (= G21), S146 (= S152), Y159 (= Y165)
- binding nicotinamide-adenine-dinucleotide: G12 (= G17), S14 (≠ N19), R15 (= R20), I17 (= I22), D66 (= D67), A67 (≠ V68), N93 (= N94), A94 (= A95), G95 (= G96), I96 (= I97), T116 (≠ V118), V144 (= V150), S146 (= S152), Y159 (= Y165), K163 (= K169), P189 (= P195), G190 (= G196), I192 (= I198), T194 (= T200), I196 (≠ M202)
7do6A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NADP bound-form) (see paper)
36% identity, 97% coverage: 8:259/260 of query aligns to 3:244/247 of 7do6A
- active site: G16 (= G21), S146 (= S152), Y159 (= Y165)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G17), S14 (≠ N19), R15 (= R20), G16 (= G21), I17 (= I22), H36 (≠ G41), S37 (= S42), G42 (≠ N47), D66 (= D67), A67 (≠ V68), N93 (= N94), A94 (= A95), G95 (= G96), I96 (= I97), T116 (≠ V118), S146 (= S152), Y159 (= Y165), K163 (= K169), I192 (= I198)
7ejhA Crystal structure of kred mutant-f147l/l153q/y190p/l199a/m205f/m206f and 2-hydroxyisoindoline-1,3-dione complex
39% identity, 97% coverage: 8:258/260 of query aligns to 6:251/253 of 7ejhA
- binding 2-oxidanylisoindole-1,3-dione: S144 (= S152), I145 (≠ L153), E146 (≠ A154), Y157 (= Y165), V197 (≠ T203), F207 (≠ A213)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G17), T17 (≠ N19), I20 (= I22), R40 (≠ S42), H41 (≠ N43), D64 (= D67), A65 (≠ V68), N91 (= N94), A92 (= A95), V114 (= V118), M142 (≠ V150), S144 (= S152), Y157 (= Y165), K161 (= K169), P189 (= P195), G190 (= G196), P191 (≠ W197), I192 (= I198), T194 (= T200), P195 (≠ D201), L196 (≠ M202)
7ejiB Crystal structure of kred f147l/l153q/y190p/l199a/m205f/m206f variant and methyl methacrylate complex
39% identity, 97% coverage: 8:258/260 of query aligns to 4:249/251 of 7ejiB
- binding methyl 2-methylprop-2-enoate: S142 (= S152), I143 (≠ L153), Y155 (= Y165), F205 (≠ A213)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G17), T15 (≠ N19), L16 (≠ R20), G17 (= G21), I18 (= I22), R38 (≠ S42), H39 (≠ N43), D62 (= D67), A63 (≠ V68), N89 (= N94), A90 (= A95), V112 (= V118), M140 (≠ V150), S142 (= S152), Y155 (= Y165), K159 (= K169), P187 (= P195), P189 (≠ W197), I190 (= I198), T192 (= T200), P193 (≠ D201), L194 (≠ M202)
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
35% identity, 97% coverage: 8:258/260 of query aligns to 8:251/258 of 4wecA
- active site: G21 (= G21), S143 (= S152), Q154 (≠ E163), Y157 (= Y165), K161 (= K169)
- binding nicotinamide-adenine-dinucleotide: G17 (= G17), A19 (≠ N19), S20 (≠ R20), G21 (= G21), I22 (= I22), D41 (≠ G41), I42 (≠ S42), V61 (= V66), D62 (= D67), V63 (= V68), N89 (= N94), T141 (≠ V150), Y157 (= Y165), K161 (= K169), P187 (= P195), P189 (≠ W197), V190 (≠ I198)
Q6WVP7 NADP-dependent (R)-specific alcohol dehydrogenase; (R)-specific ADH; Ketoreductase; KRED; EC 1.1.1.- from Lentilactobacillus kefiri (Lactobacillus kefiri) (see paper)
38% identity, 97% coverage: 8:258/260 of query aligns to 5:250/252 of Q6WVP7
Sites not aligning to the query:
3o03A Quaternary complex structure of gluconate 5-dehydrogenase from streptococcus suis type 2 (see paper)
35% identity, 97% coverage: 6:256/260 of query aligns to 7:245/254 of 3o03A
- active site: G22 (= G21), S147 (= S152), V157 (≠ N162), Y160 (= Y165), K164 (= K169)
- binding calcium ion: S147 (= S152), M148 (≠ L153), P190 (= P195)
- binding D-gluconic acid: I99 (≠ G98), R101 (≠ G100), S147 (= S152), M149 (≠ A154), R154 (≠ A159), Y160 (= Y165)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G17), Y21 (≠ R20), G22 (= G21), I23 (= I22), D42 (≠ G41), I43 (≠ S42), L47 (vs. gap), D68 (= D67), V69 (= V68), N95 (= N94), A96 (= A95), G97 (= G96), I145 (≠ V150), Y160 (= Y165), K164 (= K169), P190 (= P195)
2ztlA Closed conformation of d-3-hydroxybutyrate dehydrogenase complexed with NAD+ and l-3-hydroxybutyrate (see paper)
36% identity, 97% coverage: 8:258/260 of query aligns to 2:258/260 of 2ztlA
- active site: G15 (= G21), N114 (= N119), S142 (= S152), Y155 (= Y165), K159 (= K169), L200 (vs. gap)
- binding (3s)-3-hydroxybutanoic acid: Q94 (≠ G98), S142 (= S152), H144 (≠ A154), K152 (≠ N162), Y155 (= Y165), Q196 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: G11 (= G17), G15 (= G21), I16 (= I22), F36 (vs. gap), L64 (≠ V68), N90 (= N94), A91 (= A95), G92 (= G96), L113 (≠ V118), Y155 (= Y165), K159 (= K169), P185 (= P195), W187 (= W197), V188 (≠ I198), T190 (= T200), V193 (≠ T203)
1wmbA Crystal structure of NAD dependent d-3-hydroxybutylate dehydrogenase (see paper)
36% identity, 97% coverage: 8:258/260 of query aligns to 2:258/260 of 1wmbA
1x1tA Crystal structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas fragi complexed with NAD+ (see paper)
36% identity, 97% coverage: 8:258/260 of query aligns to 2:234/236 of 1x1tA
- active site: G15 (= G21), N114 (= N119), S142 (= S152), Y155 (= Y165), K159 (= K169)
- binding cacodylate ion: S142 (= S152), H144 (≠ A154), Y155 (= Y165), W187 (= W197), W233 (≠ Y257)
- binding nicotinamide-adenine-dinucleotide: G11 (= G17), T13 (≠ N19), S14 (≠ R20), G15 (= G21), I16 (= I22), G35 (= G41), F36 (vs. gap), D63 (= D67), L64 (≠ V68), N90 (= N94), G92 (= G96), L113 (≠ V118), S142 (= S152), Y155 (= Y165), K159 (= K169), P185 (= P195), W187 (= W197), V188 (≠ I198), T190 (= T200)
3uf0A Crystal structure of a putative NAD(p) dependent gluconate 5- dehydrogenase from beutenbergia cavernae(efi target efi-502044) with bound NADP (low occupancy)
37% identity, 97% coverage: 5:257/260 of query aligns to 2:246/249 of 3uf0A
- active site: G18 (= G21), S141 (= S152), V151 (≠ N162), Y154 (= Y165), K158 (= K169)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G17), S17 (≠ R20), G18 (= G21), I19 (= I22), R39 (≠ S42), D63 (= D67), L64 (≠ V68), N89 (= N94), G91 (= G96), I92 (= I97), I139 (≠ V150), A140 (= A151), S141 (= S152), Y154 (= Y165), K158 (= K169), P184 (= P195), G185 (= G196), V187 (≠ I198), T189 (= T200), N191 (≠ M202), T192 (= T203)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
32% identity, 97% coverage: 8:258/260 of query aligns to 3:246/248 of 6ixmC
- active site: G16 (= G21), S142 (= S152), Y155 (= Y165), K159 (= K169)
- binding nicotinamide-adenine-dinucleotide: G12 (= G17), S15 (≠ R20), G16 (= G21), I17 (= I22), D36 (≠ G41), I37 (≠ S42), A61 (≠ V66), D62 (= D67), T63 (≠ V68), N89 (= N94), A90 (= A95), M140 (≠ V150), S142 (= S152), Y155 (= Y165), K159 (= K169), P185 (= P195), A186 (≠ G196), Y187 (≠ W197), I188 (= I198), L192 (≠ M202)
7vyqA Short chain dehydrogenase (scr) cryoem structure with NADP and ethyl 4-chloroacetoacetate (see paper)
33% identity, 98% coverage: 6:259/260 of query aligns to 31:279/280 of 7vyqA
- binding ethyl 4-chloranyl-3-oxidanylidene-butanoate: T123 (≠ G98), S173 (= S152), Q183 (≠ A160), Y219 (≠ W197), F227 (≠ G205), W236 (≠ V216)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G42 (= G17), S44 (≠ N19), G45 (≠ R20), G46 (= G21), I47 (= I22), N67 (≠ S42), H69 (≠ P44), I93 (≠ V68), N119 (= N94), A120 (= A95), G121 (= G96), V144 (= V118), S173 (= S152), Y188 (= Y165), K192 (= K169), P217 (= P195), G218 (= G196), I220 (= I198), T222 (= T200), I224 (≠ M202), T225 (= T203)
7dlmA Short chain dehydrogenase (scr) crystal structure with NADPH (see paper)
33% identity, 98% coverage: 6:259/260 of query aligns to 31:279/280 of 7dlmA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G42 (= G17), S44 (≠ N19), G45 (≠ R20), G46 (= G21), I47 (= I22), Y66 (≠ G41), N67 (≠ S42), S68 (≠ N43), H69 (≠ P44), C91 (≠ V66), N92 (≠ D67), I93 (≠ V68), N119 (= N94), A120 (= A95), G121 (= G96), V122 (≠ I97), T171 (≠ V150), S173 (= S152), Y188 (= Y165), K192 (= K169), P217 (= P195), G218 (= G196), I220 (= I198), T222 (= T200), I224 (≠ M202)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
36% identity, 96% coverage: 8:256/260 of query aligns to 3:244/247 of 4jroC
- active site: G16 (= G21), S142 (= S152), Q152 (≠ N162), Y155 (= Y165), K159 (= K169)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G17), S14 (≠ N19), R15 (= R20), G16 (= G21), I17 (= I22), N35 (vs. gap), Y36 (≠ W40), N37 (≠ G41), G38 (≠ S42), S39 (≠ N43), N63 (≠ D67), V64 (= V68), N90 (= N94), A91 (= A95), I93 (= I97), I113 (≠ V118), S142 (= S152), Y155 (= Y165), K159 (= K169), P185 (= P195), I188 (= I198), T190 (= T200)
5yssB Crystal structure of aminocaproic acid cyclase in complex with NAD (+) (see paper)
33% identity, 97% coverage: 7:257/260 of query aligns to 1:252/255 of 5yssB
- binding nicotinamide-adenine-dinucleotide: G11 (= G17), T13 (≠ N19), S14 (≠ R20), G15 (= G21), I16 (= I22), G35 (= G41), F36 (≠ S42), L60 (≠ V68), N86 (= N94), G88 (= G96), I89 (= I97), A137 (= A151), Y151 (= Y165), K155 (= K169), P181 (= P195), G182 (= G196), V184 (≠ I198), T186 (= T200)
Query Sequence
>CCNA_03491 CCNA_03491 gluconate 5-dehydrogenase (Ga5DH)-related protein
MAYAPFNLSGKVALVTGGNRGIGLGMAKAMAQAGADIVIWGSNPERNLAAEQTLTALGVR
VKAQTVDVSDEAQVREGMEEAVAAMGRVDSVFANAGIGYGSPSFVDMSTEVYRKVLAVNL
DGVFFTLREACRHMVERAKAGDPGGSLVGVASLAAIEGAARNEAYAATKGAVISMIKSVA
VEHARYGVRANAILPGWIATDMTAGAQGNAAFAEKVIPRVPARRWGEPEDFGGMAVYLAS
DASSYHSGTTLVIDGGYSIF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory