SitesBLAST
Comparing CCNA_03495 FitnessBrowser__Caulo:CCNA_03495 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2ztlA Closed conformation of d-3-hydroxybutyrate dehydrogenase complexed with NAD+ and l-3-hydroxybutyrate (see paper)
56% identity, 98% coverage: 7:265/265 of query aligns to 2:260/260 of 2ztlA
- active site: G15 (= G20), N114 (= N119), S142 (= S147), Y155 (= Y160), K159 (= K164), L200 (≠ Q205)
- binding (3s)-3-hydroxybutanoic acid: Q94 (= Q99), S142 (= S147), H144 (= H149), K152 (= K157), Y155 (= Y160), Q196 (= Q201)
- binding nicotinamide-adenine-dinucleotide: G11 (= G16), G15 (= G20), I16 (= I21), F36 (≠ L41), L64 (≠ M69), N90 (= N95), A91 (= A96), G92 (= G97), L113 (≠ V118), Y155 (= Y160), K159 (= K164), P185 (= P190), W187 (≠ F192), V188 (= V193), T190 (= T195), V193 (= V198)
1wmbA Crystal structure of NAD dependent d-3-hydroxybutylate dehydrogenase (see paper)
56% identity, 98% coverage: 7:265/265 of query aligns to 2:260/260 of 1wmbA
5yssB Crystal structure of aminocaproic acid cyclase in complex with NAD (+) (see paper)
56% identity, 98% coverage: 7:265/265 of query aligns to 2:255/255 of 5yssB
- binding nicotinamide-adenine-dinucleotide: G11 (= G16), T13 (= T18), S14 (= S19), G15 (= G20), I16 (= I21), G35 (= G40), F36 (≠ L41), L60 (≠ M69), N86 (= N95), G88 (= G97), I89 (≠ V98), A137 (= A146), Y151 (= Y160), K155 (= K164), P181 (= P190), G182 (= G191), V184 (= V193), T186 (= T195)
5b4tA Crystal structure of d-3-hydroxybutyrate dehydrogenase from alcaligenes faecalis complexed with NAD+ and a substrate d-3- hydroxybutyrate (see paper)
54% identity, 98% coverage: 7:265/265 of query aligns to 2:260/260 of 5b4tA
- active site: G15 (= G20), N114 (= N119), S142 (= S147), Y155 (= Y160), K159 (= K164), I200 (≠ Q205)
- binding (3R)-3-hydroxybutanoic acid: Q94 (= Q99), S142 (= S147), H144 (= H149), K152 (= K157), Y155 (= Y160), W187 (≠ F192), Q196 (= Q201)
- binding nicotinamide-adenine-dinucleotide: G11 (= G16), T13 (= T18), G15 (= G20), I16 (= I21), F36 (≠ L41), D63 (= D68), L64 (≠ M69), N90 (= N95), G92 (= G97), L113 (≠ V118), I140 (= I145), Y155 (= Y160), K159 (= K164), P185 (= P190), G186 (= G191), W187 (≠ F192), V188 (= V193), T190 (= T195), L192 (= L197), V193 (= V198)
3w8dA Crystal structure of d-3-hydroxybutyrate dehydrogenase from alcaligenes faecalis complexed with NAD+ and an inhibitor methylmalonate
54% identity, 98% coverage: 7:265/265 of query aligns to 2:260/260 of 3w8dA
- active site: G15 (= G20), N114 (= N119), S142 (= S147), Y155 (= Y160), K159 (= K164), I200 (≠ Q205)
- binding methylmalonic acid: Q94 (= Q99), S142 (= S147), H144 (= H149), K152 (= K157), Y155 (= Y160), W187 (≠ F192), Q196 (= Q201), W257 (= W262)
- binding nicotinamide-adenine-dinucleotide: G11 (= G16), T13 (= T18), S14 (= S19), G15 (= G20), I16 (= I21), F36 (≠ L41), A62 (= A67), D63 (= D68), L64 (≠ M69), N90 (= N95), A91 (= A96), G92 (= G97), L113 (≠ V118), S142 (= S147), Y155 (= Y160), K159 (= K164), P185 (= P190), G186 (= G191), W187 (≠ F192), V188 (= V193), T190 (= T195), L192 (= L197), V193 (= V198)
3vdrA Crystal structure of d-3-hydroxybutyrate dehydrogenase, prepared in the presence of the substrate d-3-hydroxybutyrate and NAD(+) (see paper)
54% identity, 98% coverage: 7:265/265 of query aligns to 2:260/260 of 3vdrA
- active site: G15 (= G20), N114 (= N119), S142 (= S147), Y155 (= Y160), K159 (= K164), I200 (≠ Q205)
- binding (3R)-3-hydroxybutanoic acid: Q94 (= Q99), H144 (= H149), K152 (= K157), Y155 (= Y160), W187 (≠ F192), Q196 (= Q201), W257 (= W262)
- binding acetoacetic acid: Q94 (= Q99), H144 (= H149), K152 (= K157), Y155 (= Y160), W187 (≠ F192), Q196 (= Q201), W257 (= W262)
- binding nicotinamide-adenine-dinucleotide: G11 (= G16), T13 (= T18), I16 (= I21), F36 (≠ L41), D63 (= D68), L64 (≠ M69), N90 (= N95), A91 (= A96), G92 (= G97), L113 (≠ V118), K159 (= K164), G186 (= G191), V188 (= V193), T190 (= T195), L192 (= L197), V193 (= V198)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G16), T13 (= T18), I16 (= I21), F36 (≠ L41), D63 (= D68), L64 (≠ M69), N90 (= N95), A91 (= A96), G92 (= G97), L113 (≠ V118), S142 (= S147), Y155 (= Y160), K159 (= K164), G186 (= G191), V188 (= V193), T190 (= T195), L192 (= L197), V193 (= V198)
3vdqA Crystal structure of alcaligenes faecalis d-3-hydroxybutyrate dehydrogenase in complex with NAD(+) and acetate (see paper)
54% identity, 98% coverage: 7:265/265 of query aligns to 2:260/260 of 3vdqA
- active site: G15 (= G20), N114 (= N119), S142 (= S147), Y155 (= Y160), K159 (= K164), I200 (≠ Q205)
- binding acetate ion: Q94 (= Q99), H144 (= H149), K152 (= K157), W187 (≠ F192), L192 (= L197), Q196 (= Q201)
- binding nicotinamide-adenine-dinucleotide: G11 (= G16), S14 (= S19), I16 (= I21), F36 (≠ L41), D63 (= D68), L64 (≠ M69), N90 (= N95), A91 (= A96), G92 (= G97), L113 (≠ V118), I140 (= I145), S142 (= S147), Y155 (= Y160), K159 (= K164), P185 (= P190), G186 (= G191), W187 (≠ F192), V188 (= V193), T190 (= T195), L192 (= L197), V193 (= V198)
1x1tA Crystal structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas fragi complexed with NAD+ (see paper)
53% identity, 98% coverage: 7:265/265 of query aligns to 2:236/236 of 1x1tA
- active site: G15 (= G20), N114 (= N119), S142 (= S147), Y155 (= Y160), K159 (= K164)
- binding cacodylate ion: S142 (= S147), H144 (= H149), Y155 (= Y160), W187 (≠ F192), W233 (= W262)
- binding nicotinamide-adenine-dinucleotide: G11 (= G16), T13 (= T18), S14 (= S19), G15 (= G20), I16 (= I21), G35 (= G40), F36 (≠ L41), D63 (= D68), L64 (≠ M69), N90 (= N95), G92 (= G97), L113 (≠ V118), S142 (= S147), Y155 (= Y160), K159 (= K164), P185 (= P190), W187 (≠ F192), V188 (= V193), T190 (= T195)
2q2qD Structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida (see paper)
53% identity, 98% coverage: 7:265/265 of query aligns to 2:255/255 of 2q2qD
- active site: G15 (= G20), S138 (= S147), Y151 (= Y160), K155 (= K164), R196 (≠ Q205)
- binding nicotinamide-adenine-dinucleotide: G11 (= G16), T13 (= T18), S14 (= S19), G15 (= G20), I16 (= I21), F36 (≠ L41), D59 (= D68), L60 (≠ M69), N86 (= N95), G88 (= G97), L109 (≠ V118), I136 (= I145), S138 (= S147), Y151 (= Y160), K155 (= K164), P181 (= P190), G182 (= G191), W183 (≠ F192), V184 (= V193), T186 (= T195), L188 (= L197), V189 (= V198)
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
42% identity, 98% coverage: 7:265/265 of query aligns to 5:261/261 of 6zzsD
- active site: G18 (= G20), S143 (= S147), Y156 (= Y160)
- binding nicotinamide-adenine-dinucleotide: G14 (= G16), S17 (= S19), I19 (= I21), D38 (≠ E43), M39 (= M44), D64 (= D68), V65 (≠ M69), N91 (= N95), A92 (= A96), G93 (= G97), M141 (≠ I145), A142 (= A146), S143 (= S147), Y156 (= Y160), K160 (= K164), P186 (= P190), G187 (= G191), V189 (= V193), T191 (= T195), L193 (= L197)
- binding 3-oxidanylidenepentanoic acid: Q95 (= Q99), S143 (= S147), N145 (≠ H149), K153 (= K157), Y156 (= Y160), Q197 (= Q201)
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
42% identity, 98% coverage: 7:265/265 of query aligns to 4:260/260 of 6zzqA
- active site: G17 (= G20), S142 (= S147), Y155 (= Y160)
- binding acetoacetic acid: Q94 (= Q99), S142 (= S147), K152 (= K157), Y155 (= Y160), Q196 (= Q201)
- binding nicotinamide-adenine-dinucleotide: G13 (= G16), S16 (= S19), G17 (= G20), I18 (= I21), D37 (≠ E43), M38 (= M44), D63 (= D68), V64 (≠ M69), N90 (= N95), A91 (= A96), G92 (= G97), M140 (≠ I145), A141 (= A146), S142 (= S147), Y155 (= Y160), K159 (= K164), Y187 (≠ F192), V188 (= V193), T190 (= T195)
6zzpA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with NAD+ and 3-oxovalerate (see paper)
38% identity, 97% coverage: 7:262/265 of query aligns to 8:262/265 of 6zzpA
- binding nicotinamide-adenine-dinucleotide: G17 (= G16), S20 (= S19), G21 (= G20), I22 (= I21), D41 (≠ E43), I42 (≠ M44), M66 (≠ A67), D67 (= D68), V68 (≠ M69), N94 (= N95), A95 (= A96), G96 (= G97), M145 (≠ I145), S147 (= S147), Y160 (= Y160), K164 (= K164), P190 (= P190), F192 (= F192), V193 (= V193), T195 (= T195), L197 (= L197), V198 (= V198)
- binding 3-oxidanylidenepentanoic acid: Q98 (= Q99), S147 (= S147), H149 (= H149), K157 (= K157), Y160 (= Y160), F192 (= F192), Q201 (= Q201)
6zzoC Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with NAD+ and acetoacetate (see paper)
38% identity, 97% coverage: 7:262/265 of query aligns to 8:262/265 of 6zzoC
- binding acetoacetic acid: Q98 (= Q99), H149 (= H149), K157 (= K157), F192 (= F192), Q201 (= Q201)
- binding nicotinamide-adenine-dinucleotide: G17 (= G16), S20 (= S19), G21 (= G20), I22 (= I21), D41 (≠ E43), I42 (≠ M44), M66 (≠ A67), D67 (= D68), V68 (≠ M69), N94 (= N95), A95 (= A96), G96 (= G97), M145 (≠ I145), Y160 (= Y160), K164 (= K164), P190 (= P190), F192 (= F192), V193 (= V193), T195 (= T195), L197 (= L197), V198 (= V198)
8dt1C Crystal structure of a putative d-beta-hydroxybutyrate dehydrogenase from burkholderia cenocepacia j2315 in complex with NAD
37% identity, 98% coverage: 7:265/265 of query aligns to 2:259/259 of 8dt1C
- binding nicotinamide-adenine-dinucleotide: G11 (= G16), S14 (= S19), G15 (= G20), I16 (= I21), D35 (≠ G40), L36 (= L41), M60 (≠ A67), V62 (≠ M69), N88 (= N95), A89 (= A96), M139 (≠ I145), Y154 (= Y160), K158 (= K164), P184 (= P190), G185 (= G191), F186 (= F192), V187 (= V193), T189 (= T195)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
37% identity, 97% coverage: 7:263/265 of query aligns to 3:246/247 of 4jroC
- active site: G16 (= G20), S142 (= S147), Q152 (≠ K157), Y155 (= Y160), K159 (= K164)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G16), S14 (≠ T18), R15 (≠ S19), G16 (= G20), I17 (= I21), N35 (= N39), Y36 (≠ G40), N37 (≠ L41), G38 (= G42), S39 (≠ E43), N63 (≠ D68), V64 (≠ M69), N90 (= N95), A91 (= A96), I93 (≠ V98), I113 (≠ V118), S142 (= S147), Y155 (= Y160), K159 (= K164), P185 (= P190), I188 (≠ V193), T190 (= T195)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
33% identity, 97% coverage: 7:264/265 of query aligns to 3:247/248 of 6ixmC
- active site: G16 (= G20), S142 (= S147), Y155 (= Y160), K159 (= K164)
- binding nicotinamide-adenine-dinucleotide: G12 (= G16), S15 (= S19), G16 (= G20), I17 (= I21), D36 (≠ G40), I37 (≠ L41), A61 (= A67), D62 (= D68), T63 (≠ M69), N89 (= N95), A90 (= A96), M140 (≠ I145), S142 (= S147), Y155 (= Y160), K159 (= K164), P185 (= P190), A186 (≠ G191), Y187 (≠ F192), I188 (≠ V193), L192 (= L197)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
33% identity, 98% coverage: 5:265/265 of query aligns to 2:252/252 of 1vl8B
- active site: G17 (= G20), S143 (= S147), I154 (≠ K157), Y157 (= Y160), K161 (= K164)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G16), R16 (≠ S19), G17 (= G20), L18 (≠ I21), S37 (≠ G40), R38 (≠ L41), C63 (≠ A67), D64 (= D68), V65 (≠ M69), A91 (≠ N95), A92 (= A96), G93 (= G97), I94 (≠ V98), V114 (= V118), I141 (= I145), S143 (= S147), Y157 (= Y160), K161 (= K164), P187 (= P190), G188 (= G191), Y190 (≠ V193), T192 (= T195), M194 (≠ L197), T195 (≠ V198)
2cfcA Structural basis for stereo selectivity in the (r)- and (s)-hydroxypropylethane thiosulfonate dehydrogenases (see paper)
36% identity, 96% coverage: 10:264/265 of query aligns to 3:249/250 of 2cfcA
- active site: G13 (= G20), S142 (= S147), Y155 (= Y160), K159 (= K164)
- binding (2-[2-ketopropylthio]ethanesulfonate: F149 (≠ S154), R152 (≠ K157), Y155 (= Y160), W195 (≠ A200), R196 (≠ Q201)
- binding nicotinamide-adenine-dinucleotide: G9 (= G16), S12 (= S19), G13 (= G20), N14 (≠ I21), D33 (≠ G40), L34 (= L41), A59 (= A67), D60 (= D68), V61 (≠ M69), N87 (= N95), A88 (= A96), G89 (= G97), I140 (= I145), P185 (= P190), G186 (= G191), M187 (≠ F192), I188 (≠ V193), T190 (= T195), P191 (= P196), M192 (≠ L197), T193 (≠ V198)
Q56840 2-(R)-hydroxypropyl-CoM dehydrogenase; R-HPCDH; 2-[(R)-2-hydroxypropylthio]ethanesulfonate dehydrogenase; Aliphatic epoxide carboxylation component III; Epoxide carboxylase component III; RHPCDH1; EC 1.1.1.268 from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) (see 4 papers)
36% identity, 96% coverage: 10:264/265 of query aligns to 3:249/250 of Q56840
- SGN 12:14 (≠ SGI 19:21) binding
- D33 (≠ G40) binding
- DV 60:61 (≠ DM 68:69) binding
- N87 (= N95) binding
- S142 (= S147) mutation to A: Retains weak activity. 120-fold decrease in kcat.; mutation to C: Loss of activity.
- R152 (≠ K157) binding ; mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- Y155 (= Y160) mutation Y->E,F: Loss of activity.
- K159 (= K164) mutation to A: Loss of activity.
- R179 (≠ T184) mutation to A: Loss of activity.
- IETPM 188:192 (≠ VKTPL 193:197) binding
- WR 195:196 (≠ AQ 200:201) binding
- R196 (≠ Q201) mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- R203 (= R218) mutation to A: Slight decrease in catalytic efficiency.
- R209 (≠ S224) mutation to A: Does not affect catalytic efficiency.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
33% identity, 96% coverage: 7:261/265 of query aligns to 3:240/244 of 6t77A
- active site: G16 (= G20), S138 (= S147), Y151 (= Y160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G16), S14 (≠ T18), R15 (≠ S19), T37 (≠ L41), L58 (≠ Y64), N59 (≠ H65), V60 (≠ M69), A87 (= A96), G88 (= G97), I89 (≠ V98)
Query Sequence
>CCNA_03495 FitnessBrowser__Caulo:CCNA_03495
MAVDFGLQGQVAIVTGSTSGIGHAMADALAAQGCNIVMNGLGEMNAIERARAEMAETHGV
EVLYHGADMTRPIEIADMVRAAKAEFGELDILVNNAGVQHVAPVEDFPEDKWDLIIAVNL
SSAFHATKAAVPIMKEQGRGRIVNIASAHGLVASPFKSAYVAAKHGIMGLTKTVALEVAQ
HGITCNAICPGFVKTPLVEAQIADQAKARGISEEAVMRDVILASQPTKQFVTFDQLNGML
LYLVSDLGASANGAAYQIDGGWVAQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory