SitesBLAST
Comparing CCNA_03500 FitnessBrowser__Caulo:CCNA_03500 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
46% identity, 98% coverage: 8:465/469 of query aligns to 5:461/465 of 3pm9A
- active site: A149 (= A151), L159 (≠ M161)
- binding flavin-adenine dinucleotide: P69 (= P72), Q70 (= Q73), G71 (= G74), G72 (= G75), N73 (= N76), T74 (= T77), G75 (= G78), L76 (= L79), G79 (= G82), Q80 (= Q83), L91 (≠ T93), L133 (≠ V135), G134 (≠ A136), A135 (≠ S137), C139 (= C141), T140 (= T142), G142 (= G144), G143 (= G145), S146 (= S148), T147 (= T149), A149 (= A151), G150 (= G152), E200 (= E202), G201 (= G203), I205 (= I207), I206 (≠ V208), E423 (= E427)
P39976 D-2-hydroxyglutarate--pyruvate transhydrogenase DLD3; D-2HG--pyruvate transhydrogenase DLD3; (R)-2-hydroxyglutarate--pyruvate transhydrogenase; D-lactate dehydrogenase [cytochrome] 3; D-lactate ferricytochrome C oxidoreductase; D-LCR; EC 1.1.99.40; EC 1.1.2.4 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
33% identity, 92% coverage: 35:465/469 of query aligns to 59:492/496 of P39976
Sites not aligning to the query:
- 17 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
35% identity, 95% coverage: 20:465/469 of query aligns to 23:460/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R331), T337 (≠ S335), K348 (= K346), Y379 (≠ F379), H381 (= H381), H388 (= H388), H423 (= H428)
- binding flavin-adenine dinucleotide: W39 (= W36), P75 (= P72), Q76 (= Q73), G77 (= G74), G78 (= G75), N79 (= N76), T80 (= T77), G81 (= G78), M82 (≠ L79), G85 (= G82), S86 (≠ Q83), L139 (≠ V135), G140 (≠ A136), A141 (≠ S137), C145 (= C141), G149 (= G145), N150 (≠ L146), A152 (≠ S148), T153 (= T149), G157 (= G153), G207 (= G203), I212 (≠ V208), E422 (= E427), N459 (= N464)
- binding zinc ion: H381 (= H381), H388 (= H388), E422 (= E427)
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
35% identity, 95% coverage: 20:465/469 of query aligns to 23:460/466 of 6lpuA
- binding flavin-adenine dinucleotide: W39 (= W36), P75 (= P72), G77 (= G74), G78 (= G75), N79 (= N76), T80 (= T77), G81 (= G78), G85 (= G82), S86 (≠ Q83), L139 (≠ V135), G140 (≠ A136), A141 (≠ S137), C145 (= C141), H146 (≠ T142), G148 (= G144), G149 (= G145), N150 (≠ L146), A152 (≠ S148), T153 (= T149), A155 (= A151), E206 (= E202), G207 (= G203), I211 (= I207), I212 (≠ V208), E422 (= E427), N459 (= N464)
- binding (2s)-2-hydroxypentanedioic acid: R333 (= R331), T337 (≠ S335), K348 (= K346), Y379 (≠ F379), H381 (= H381), H388 (= H388), H423 (= H428)
- binding zinc ion: H381 (= H381), H388 (= H388), E422 (= E427)
6lpqA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) (see paper)
35% identity, 95% coverage: 20:465/469 of query aligns to 23:460/466 of 6lpqA
- binding flavin-adenine dinucleotide: W39 (= W36), P75 (= P72), G77 (= G74), G78 (= G75), N79 (= N76), T80 (= T77), G81 (= G78), G85 (= G82), S86 (≠ Q83), L139 (≠ V135), G140 (≠ A136), A141 (≠ S137), C145 (= C141), H146 (≠ T142), G149 (= G145), N150 (≠ L146), A152 (≠ S148), T153 (= T149), A155 (= A151), G157 (= G153), E206 (= E202), G207 (= G203), I211 (= I207), I212 (≠ V208), E422 (= E427), N459 (= N464)
- binding d-malate: M82 (≠ L79), R333 (= R331), T337 (≠ S335), K348 (= K346), Y379 (≠ F379), H381 (= H381), H388 (= H388), E422 (= E427), H423 (= H428)
- binding zinc ion: H381 (= H381), H388 (= H388), E422 (= E427)
6lppA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-2-hydroxyglutarate (d-2-hg) (see paper)
35% identity, 95% coverage: 20:465/469 of query aligns to 23:460/466 of 6lppA
- binding (2R)-2-hydroxypentanedioic acid: R333 (= R331), T337 (≠ S335), K348 (= K346), Y379 (≠ F379), H381 (= H381), H388 (= H388), N390 (≠ D390), H423 (= H428)
- binding flavin-adenine dinucleotide: W39 (= W36), P75 (= P72), G77 (= G74), G78 (= G75), N79 (= N76), T80 (= T77), G81 (= G78), M82 (≠ L79), G85 (= G82), S86 (≠ Q83), L139 (≠ V135), G140 (≠ A136), A141 (≠ S137), C145 (= C141), G149 (= G145), N150 (≠ L146), A152 (≠ S148), T153 (= T149), A155 (= A151), G157 (= G153), G207 (= G203), I212 (≠ V208), E422 (= E427), H423 (= H428)
- binding zinc ion: H381 (= H381), H388 (= H388), E422 (= E427)
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
35% identity, 95% coverage: 20:465/469 of query aligns to 24:461/467 of 6lpnB
- binding flavin-adenine dinucleotide: W40 (= W36), P76 (= P72), G78 (= G74), G79 (= G75), N80 (= N76), T81 (= T77), G82 (= G78), M83 (≠ L79), G86 (= G82), S87 (≠ Q83), L140 (≠ V135), A142 (≠ S137), C146 (= C141), H147 (≠ T142), G150 (= G145), N151 (≠ L146), A153 (≠ S148), T154 (= T149), G208 (= G203), I212 (= I207), I213 (≠ V208), E423 (= E427), N460 (= N464)
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
35% identity, 95% coverage: 20:465/469 of query aligns to 76:513/521 of Q8N465
- S109 (≠ T53) to W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- N127 (≠ T71) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (= G75) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (≠ L90) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (≠ L96) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (≠ V115) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (≠ T132) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (≠ S148) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (≠ P174) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G176) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
- D375 (≠ T320) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- R386 (= R331) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- T390 (≠ S335) binding ; binding ; mutation to A: Significantly reduced catalytic activity.
- V399 (= V344) to M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- K401 (= K346) binding ; binding ; mutation to A: Loss of catalytic activity.
- R419 (≠ N364) to H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- A426 (≠ G373) to T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- H434 (= H381) binding ; mutation to A: Loss of catalytic activity.
- G436 (= G383) to V: slight reduction in catalytic activity
- N439 (= N386) to D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- H441 (= H388) binding ; mutation to A: Loss of catalytic activity.
- N443 (≠ D390) binding ; mutation to A: Significantly reduced catalytic activity.
- V444 (= V391) to A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- A446 (≠ G399) to V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- E475 (= E427) binding ; mutation to A: Loss of catalytic activity.
- H476 (= H428) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- G477 (= G429) to R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
31% identity, 90% coverage: 50:469/469 of query aligns to 46:456/459 of P9WIT1
- K354 (≠ D358) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
28% identity, 90% coverage: 46:466/469 of query aligns to 47:461/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ P72), G75 (= G74), S76 (≠ G75), G77 (≠ N76), T78 (= T77), G79 (= G78), L80 (= L79), A83 (≠ G82), C84 (≠ Q83), P137 (≠ A136), G138 (≠ S137), E139 (= E138), A142 (≠ C141), T143 (= T142), G146 (= G145), N147 (≠ L146), S149 (= S148), T150 (= T149), A152 (= A151), G153 (= G152), E203 (= E202), G204 (= G203), I209 (≠ V208), E422 (= E427), H423 (= H428)
- binding fe (iii) ion: H377 (= H381), H384 (= H388), E422 (= E427)
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
29% identity, 89% coverage: 47:465/469 of query aligns to 43:450/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (≠ W328), W322 (≠ E332), H369 (= H381), H376 (= H388), H413 (= H428)
- binding flavin-adenine dinucleotide: P68 (= P72), G70 (= G74), T71 (≠ G75), G72 (≠ N76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ Q83), L90 (≠ T93), P132 (≠ V135), G133 (≠ A136), A134 (≠ S137), G140 (= G145), M141 (≠ L146), A143 (≠ S148), T144 (= T149), A146 (= A151), S147 (≠ G152), E200 (= E202), G201 (= G203), I206 (≠ V208), W322 (≠ E332), E412 (= E427), H413 (= H428), N449 (= N464)
- binding manganese (ii) ion: H369 (= H381), H376 (= H388), E412 (= E427)
Sites not aligning to the query:
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
29% identity, 89% coverage: 47:465/469 of query aligns to 43:450/454 of 8jdyA
- binding 2-oxo-4-methylpentanoic acid: R318 (≠ W328), W322 (≠ E332), S336 (≠ K346), H369 (= H381), H376 (= H388), H413 (= H428)
- binding flavin-adenine dinucleotide: P68 (= P72), G70 (= G74), T71 (≠ G75), G72 (≠ N76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ Q83), L90 (≠ T93), P132 (≠ V135), G133 (≠ A136), A134 (≠ S137), G140 (= G145), M141 (≠ L146), A143 (≠ S148), T144 (= T149), A146 (= A151), S147 (≠ G152), E200 (= E202), G201 (= G203), I206 (≠ V208), E412 (= E427), N449 (= N464)
- binding manganese (ii) ion: H369 (= H381), H376 (= H388), E412 (= E427)
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
28% identity, 89% coverage: 47:465/469 of query aligns to 43:451/455 of 8jdxA
- binding flavin-adenine dinucleotide: P68 (= P72), G70 (= G74), T71 (≠ G75), G72 (≠ N76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ Q83), L90 (≠ T93), P132 (≠ V135), G133 (≠ A136), A134 (≠ S137), G140 (= G145), M141 (≠ L146), A143 (≠ S148), T144 (= T149), A146 (= A151), S147 (≠ G152), E200 (= E202), G201 (= G203), I206 (≠ V208), W322 (≠ E332), E413 (= E427), H414 (= H428), N450 (= N464)
- binding 3-methyl-2-oxobutanoic acid: R318 (≠ W328), H369 (= H381), H376 (= H388), H414 (= H428)
- binding manganese (ii) ion: H369 (= H381), H376 (= H388), E413 (= E427)
Sites not aligning to the query:
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
28% identity, 89% coverage: 47:465/469 of query aligns to 43:452/456 of 8jdsA
- binding flavin-adenine dinucleotide: P68 (= P72), G70 (= G74), T71 (≠ G75), G72 (≠ N76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ Q83), L90 (≠ T93), P132 (≠ V135), G133 (≠ A136), A134 (≠ S137), G140 (= G145), M141 (≠ L146), A143 (≠ S148), T144 (= T149), A146 (= A151), S147 (≠ G152), E200 (= E202), G201 (= G203), I206 (≠ V208), W323 (≠ E332), E414 (= E427), H415 (= H428), N451 (= N464)
- binding manganese (ii) ion: H370 (= H381), H377 (= H388), E414 (= E427)
- binding pyruvic acid: R319 (≠ W328), H370 (= H381), H377 (= H388), H415 (= H428)
Sites not aligning to the query:
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
28% identity, 89% coverage: 47:465/469 of query aligns to 43:451/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (≠ W328), H369 (= H381), H376 (= H388), H414 (= H428)
- binding flavin-adenine dinucleotide: P68 (= P72), G70 (= G74), T71 (≠ G75), G72 (≠ N76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ Q83), L90 (≠ T93), P132 (≠ V135), G133 (≠ A136), A134 (≠ S137), G140 (= G145), M141 (≠ L146), A143 (≠ S148), T144 (= T149), A146 (= A151), S147 (≠ G152), E200 (= E202), G201 (= G203), I206 (≠ V208), W322 (≠ E332), E413 (= E427), H414 (= H428), N450 (= N464)
- binding manganese (ii) ion: H369 (= H381), H376 (= H388), E413 (= E427)
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
28% identity, 89% coverage: 47:465/469 of query aligns to 43:450/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ L79), R317 (≠ W328), W321 (≠ E332), H368 (= H381), H375 (= H388), H413 (= H428)
- binding flavin-adenine dinucleotide: P68 (= P72), G70 (= G74), T71 (≠ G75), G72 (≠ N76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ Q83), L90 (≠ T93), P132 (≠ V135), G133 (≠ A136), A134 (≠ S137), G140 (= G145), M141 (≠ L146), A143 (≠ S148), T144 (= T149), A146 (= A151), S147 (≠ G152), E200 (= E202), G201 (= G203), I206 (≠ V208), W321 (≠ E332), Y322 (≠ G333), E412 (= E427), H413 (= H428), N449 (= N464)
- binding manganese (ii) ion: H368 (= H381), H375 (= H388), E412 (= E427)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
28% identity, 89% coverage: 47:465/469 of query aligns to 43:451/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (≠ W328), W322 (≠ E332), H369 (= H381), H376 (= H388), H414 (= H428)
- binding flavin-adenine dinucleotide: P68 (= P72), G70 (= G74), T71 (≠ G75), G72 (≠ N76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ Q83), L90 (≠ T93), P132 (≠ V135), G133 (≠ A136), A134 (≠ S137), G140 (= G145), M141 (≠ L146), A143 (≠ S148), T144 (= T149), A146 (= A151), S147 (≠ G152), E200 (= E202), G201 (= G203), I206 (≠ V208), W322 (≠ E332), E413 (= E427), N450 (= N464)
- binding manganese (ii) ion: H369 (= H381), H376 (= H388), E413 (= E427)
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
28% identity, 89% coverage: 47:465/469 of query aligns to 43:451/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (= P72), G70 (= G74), T71 (≠ G75), G72 (≠ N76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ Q83), L90 (≠ T93), P132 (≠ V135), G133 (≠ A136), A134 (≠ S137), G140 (= G145), M141 (≠ L146), A143 (≠ S148), T144 (= T149), A146 (= A151), S147 (≠ G152), E200 (= E202), G201 (= G203), I206 (≠ V208), W322 (≠ E332), E413 (= E427), H414 (= H428), N450 (= N464)
- binding lactic acid: R318 (≠ W328), H369 (= H381), H376 (= H388), H414 (= H428)
- binding manganese (ii) ion: H369 (= H381), H376 (= H388), E413 (= E427)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
27% identity, 89% coverage: 47:465/469 of query aligns to 43:452/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (= P72), G70 (= G74), T71 (≠ G75), G72 (≠ N76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ Q83), L90 (≠ T93), P132 (≠ V135), G133 (≠ A136), A134 (≠ S137), G140 (= G145), M141 (≠ L146), A143 (≠ S148), T144 (= T149), A146 (= A151), S147 (≠ G152), E200 (= E202), G201 (= G203), I206 (≠ V208), Y324 (≠ G333), H370 (= H381), E414 (= E427), N451 (= N464)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (≠ W328), W323 (≠ E332), H415 (= H428)
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
27% identity, 89% coverage: 47:465/469 of query aligns to 43:452/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (≠ W328), W323 (≠ E332), H370 (= H381), H415 (= H428)
- binding flavin-adenine dinucleotide: P68 (= P72), G70 (= G74), T71 (≠ G75), G72 (≠ N76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ Q83), L90 (≠ T93), P132 (≠ V135), G133 (≠ A136), A134 (≠ S137), G140 (= G145), M141 (≠ L146), A143 (≠ S148), T144 (= T149), A146 (= A151), S147 (≠ G152), E200 (= E202), G201 (= G203), I206 (≠ V208), H370 (= H381), E414 (= E427), N451 (= N464)
Query Sequence
>CCNA_03500 FitnessBrowser__Caulo:CCNA_03500
MTKPVPADVVSRLKAVLGEGGWSQDRDVIAPKLVEWRGRWQGETPLLVTPRSTAEVAAVV
GICAAEGVAITPQGGNTGLVAGQIPRGEILLSTQKLTAIRDVDPIDDAMVLEAGVTLYEA
HQQAAKVGRRFTVGVASEGSCTIGGLISTNAGGTAVLRYGMMREQVLGIEAVLPNGEIWN
GLKRLRKDNTGYDLKQLLIGAEGTLGIVTAASLKLQALLASRAVAIVGLASPANAIQLLA
RAKDETGGAVEAFELMGRLGFELTVRNVPGLRDPLPEAHPWYVLIEIASGEPGAAEAALE
RLLAGALERGLIADAAVAQTETQMKAFWHIREGHSAGQKPEGAVWKHDVSVPVSKIPDFI
GQANAAIEKSFPGTRIVAFGHVGDGNVHYDVLQPVGGDGDAHGAQREAGAKIVHDITAGF
GGSISAEHGLGAMKTAEALTYKDPIEVAALRAIRGALDPQRIMNPRVLF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory