Comparing CCNA_03510 FitnessBrowser__Caulo:CCNA_03510 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
4f4fA X-ray crystal structure of plp bound threonine synthase from brucella melitensis
53% identity, 99% coverage: 1:459/465 of query aligns to 2:459/464 of 4f4fA
Q42598 Threonine synthase; TS; EC 4.2.3.1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
41% identity, 91% coverage: 3:423/465 of query aligns to 7:462/514 of Q42598
1kl7A Crystal structure of threonine synthase from yeast (see paper)
41% identity, 91% coverage: 3:423/465 of query aligns to 7:459/509 of 1kl7A
1vb3A Crystal structure of threonine synthase from escherichia coli
34% identity, 98% coverage: 1:458/465 of query aligns to 1:424/428 of 1vb3A
8g1yA Crystal structure of the threonine synthase from streptococcus pneumoniae in complex with pyridoxal 5-phosphate.
34% identity, 91% coverage: 1:425/465 of query aligns to 5:442/496 of 8g1yA
>CCNA_03510 FitnessBrowser__Caulo:CCNA_03510
MRYVSTRGQSAPIGFLDAVLAGLAPDGGLYVPAEWPSFTAKQIAAFAGKPYAEVAAAVVG
KFVGDDIPADDLLQMCEEAYATFAHTAVTPVKQLTANRYLLELFHGPTLAFKDVAMQLLG
RLYDYVLERQSRKMTIICATSGDTGGAAVEAFRGRKNARIVALFPEGRISEVQRRFMTTA
TDANVACVSVLGSFDDCQAIVKQAFQDDQFRHAVDLSGVNSINWARIAAQSVYYFTAAVA
LGAPAREVAFVVPTGNFGDAYAAFVAKTLGLPIHSVTAATNSNDILARAFEDGRYSRGAV
AATQSPAMDIQVASNFERLYFEAVRRDGVETGRAFRAFADTGLLDIPPAAHAWMRELFRG
ASVSEADTAKTMLSTLNETGEVVDPHTAVGLAAAQGVRIDPAIPVVVLSTAHPAKFPEAV
QAATGLLPSTPRATPDLSKKPEKFERLPADGSSVKAFVRTFAANS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory