Comparing CCNA_03575 FitnessBrowser__Caulo:CCNA_03575 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P09110 3-ketoacyl-CoA thiolase, peroxisomal; Acetyl-CoA C-myristoyltransferase; Acetyl-CoA acyltransferase; Beta-ketothiolase; Peroxisomal 3-oxoacyl-CoA thiolase; EC 2.3.1.16; EC 2.3.1.155; EC 2.3.1.9 from Homo sapiens (Human) (see 3 papers)
44% identity, 99% coverage: 3:393/395 of query aligns to 37:420/424 of P09110
Sites not aligning to the query:
2d3tC Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form v (see paper)
41% identity, 99% coverage: 2:393/395 of query aligns to 5:388/390 of 2d3tC
1ou6A Biosynthetic thiolase from zoogloea ramigera in complex with acetyl-o- pantetheine-11-pivalate
42% identity, 98% coverage: 5:393/395 of query aligns to 6:390/392 of 1ou6A
2vu1A Biosynthetic thiolase from z. Ramigera. Complex of with o-pantheteine- 11-pivalate. (see paper)
42% identity, 98% coverage: 5:393/395 of query aligns to 5:389/391 of 2vu1A
2vu2A Biosynthetic thiolase from z. Ramigera. Complex with s-pantetheine-11- pivalate. (see paper)
42% identity, 98% coverage: 5:393/395 of query aligns to 3:387/389 of 2vu2A
1dm3A Acetylated biosynthetic thiolase from zoogloea ramigera in complex with acetyl-coa (see paper)
42% identity, 98% coverage: 5:393/395 of query aligns to 3:387/389 of 1dm3A
1dlvA Biosynthetic thiolase from zoogloea ramigera in complex with coa (see paper)
42% identity, 98% coverage: 5:393/395 of query aligns to 3:387/389 of 1dlvA
P07097 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; Beta-ketothiolase; EC 2.3.1.9 from Shinella zoogloeoides (Crabtreella saccharophila) (see 2 papers)
41% identity, 99% coverage: 4:393/395 of query aligns to 5:390/392 of P07097
2wkuA Biosynthetic thiolase from z. Ramigera. The n316h mutant. (see paper)
41% identity, 98% coverage: 5:393/395 of query aligns to 3:387/389 of 2wkuA
1m1oA Crystal structure of biosynthetic thiolase, c89a mutant, complexed with acetoacetyl-coa (see paper)
41% identity, 98% coverage: 5:393/395 of query aligns to 4:388/390 of 1m1oA
P45359 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; CaTHL; EC 2.3.1.9 from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) (see paper)
41% identity, 99% coverage: 1:393/395 of query aligns to 1:390/392 of P45359
4xl4A Crystal structure of thiolase from clostridium acetobutylicum in complex with coa (see paper)
41% identity, 99% coverage: 1:393/395 of query aligns to 1:390/392 of 4xl4A
8oqmD Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-10
39% identity, 99% coverage: 3:393/395 of query aligns to 4:397/399 of 8oqmD
Sites not aligning to the query:
8opxC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with trehalose (fragment-b-tre)
39% identity, 99% coverage: 3:393/395 of query aligns to 3:396/398 of 8opxC
8oqoC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-49
39% identity, 99% coverage: 3:393/395 of query aligns to 3:396/398 of 8oqoC
8oqlC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-1
39% identity, 99% coverage: 3:393/395 of query aligns to 3:395/397 of 8oqlC
P14611 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; Beta-ketothiolase; EC 2.3.1.9 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see paper)
41% identity, 98% coverage: 1:389/395 of query aligns to 1:387/393 of P14611
5f38D X-ray crystal structure of a thiolase from escherichia coli at 1.8 a resolution (see paper)
39% identity, 99% coverage: 1:393/395 of query aligns to 3:393/394 of 5f38D
8opuC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with sulfamethoxazole (fragment-b-e1)
38% identity, 99% coverage: 3:393/395 of query aligns to 3:397/399 of 8opuC
4o9cC Crystal structure of beta-ketothiolase (phaa) from ralstonia eutropha h16 (see paper)
41% identity, 98% coverage: 1:389/395 of query aligns to 1:387/393 of 4o9cC
>CCNA_03575 FitnessBrowser__Caulo:CCNA_03575
MREAVIVSYARTGLAKSVRGGFNNTHGAAMAGHAIQHAVSRAGLEGAEVEDVVLGCGGPE
GATGMNVARNAAMWAGLPVTTSGQTINRFCSSGLQAIATAANYVRNDGANVAIGGGVESI
SLVNAGGHMNRFHITEEKLMQTHPALWMAMIDTADIVAKRYNVSREYQDEYALRSQQRIA
AAQAAGLFKDEIVPMATKMKVVNKETKEESFVDYVVDKDECNRADTTLEGLASLKPVMGE
GKFITAGNASQLSDGAAAVVVMEAKEAEKRGLTPLGAFRGFAVAGCEPDEMGIGPVFAVP
RLLERHGLKVDDIDIWELNEAFASQCLYSRDRLGIDPEKYNVNGGSIAIGHPFGMTGARC
AGHLLLEGKRRKAKLGVVTMCIGGGMGAAGLFEIF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory