Comparing CCNA_03666 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found no hits to proteins with known functional sites (download)
>CCNA_03666
MRKRALLMALIATGALGAAACTPTVRVKVDPINIYAKLDADVRVRLDKEVQSLIQQNPNL
F
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory