SitesBLAST
Comparing CCNA_03704 FitnessBrowser__Caulo:CCNA_03704 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9R4E4 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Agrobacterium sp. (strain CP4) (see 2 papers)
57% identity, 96% coverage: 14:440/443 of query aligns to 18:447/455 of Q9R4E4
- KS 28:29 (= KS 24:25) binding
- R33 (= R29) binding
- NAAT 98:101 (≠ NAGT 93:96) Phosphoenolpyruvate
- A100 (≠ G95) mutation to G: Confers resistance to glyphosate.
- R128 (= R123) binding
- K353 (= K350) binding
- R357 (= R354) binding
- R405 (= R398) binding
2pqcA Cp4 epsps liganded with (r)-phosphonate tetrahedral reaction intermediate analog (see paper)
57% identity, 96% coverage: 14:440/443 of query aligns to 13:442/445 of 2pqcA
- active site: K23 (= K24), S24 (= S25), D50 (= D51), N93 (= N93), R123 (= R123), D321 (= D323), E349 (= E351), H399 (= H397), R400 (= R398), T426 (= T424)
- binding [3r-[3a,4a,5b(r*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: K23 (= K24), S24 (= S25), R28 (= R29), T96 (= T96), R123 (= R123), S168 (= S167), Q170 (= Q169), D321 (= D323), K348 (= K350), E349 (= E351), R352 (= R354), R400 (= R398)
2pqbA Cp4 epsps liganded with (r)-difluoromethyl tetrahedral intermediate analog (see paper)
57% identity, 96% coverage: 14:440/443 of query aligns to 13:442/445 of 2pqbA
- active site: K23 (= K24), S24 (= S25), D50 (= D51), N93 (= N93), R123 (= R123), D321 (= D323), E349 (= E351), H399 (= H397), R400 (= R398), T426 (= T424)
- binding (3r,4s,5r)-5-[(1r)-1-carboxy-2,2-difluoro-1-(phosphonooxy)ethoxy]-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K23 (= K24), S24 (= S25), R28 (= R29), A95 (≠ G95), T96 (= T96), R123 (= R123), S168 (= S167), Q170 (= Q169), D321 (= D323), K348 (= K350), E349 (= E351), R352 (= R354), R400 (= R398)
2ggaA Cp4 epsp synthase liganded with s3p and glyphosate (see paper)
57% identity, 96% coverage: 14:440/443 of query aligns to 13:442/445 of 2ggaA
- active site: K23 (= K24), S24 (= S25), D50 (= D51), N93 (= N93), R123 (= R123), D321 (= D323), E349 (= E351), H399 (= H397), R400 (= R398), T426 (= T424)
- binding glyphosate: K23 (= K24), A94 (= A94), A95 (≠ G95), T96 (= T96), R123 (= R123), D321 (= D323), E349 (= E351), R352 (= R354), R400 (= R398)
- binding shikimate-3-phosphate: S24 (= S25), R28 (= R29), S168 (= S167), A169 (= A168), Q170 (= Q169), R195 (= R194), D321 (= D323), K348 (= K350)
2gg6A Cp4 epsp synthase liganded with s3p (see paper)
57% identity, 96% coverage: 14:440/443 of query aligns to 13:442/445 of 2gg6A
- active site: K23 (= K24), S24 (= S25), D50 (= D51), N93 (= N93), R123 (= R123), D321 (= D323), E349 (= E351), H399 (= H397), R400 (= R398), T426 (= T424)
- binding shikimate-3-phosphate: S24 (= S25), R28 (= R29), T96 (= T96), S168 (= S167), Q170 (= Q169), D321 (= D323), K348 (= K350)
Q83E11 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
41% identity, 97% coverage: 7:437/443 of query aligns to 4:426/438 of Q83E11
- KS 21:22 (= KS 24:25) binding
- R26 (= R29) binding
- NSGT 93:96 (≠ NAGT 93:96) Phosphoenolpyruvate
- R123 (= R123) binding
- D315 (= D323) active site, Proton acceptor
- K342 (= K350) binding
- R346 (= R354) binding
- R387 (= R398) binding
3slhD 1.70 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with shikimate-3-phosphate and glyphosate
41% identity, 98% coverage: 7:440/443 of query aligns to 6:431/440 of 3slhD
- active site: K23 (= K24), S24 (= S25), D50 (= D51), N95 (= N93), R125 (= R123), D317 (= D323), E345 (= E351), H388 (= H397), R389 (= R398), T415 (= T424)
- binding glyphosate: K23 (= K24), G97 (= G95), T98 (= T96), R125 (= R123), Q171 (= Q169), D317 (= D323), E345 (= E351), R348 (= R354), H388 (= H397), R389 (= R398)
- binding shikimate-3-phosphate: S24 (= S25), R28 (= R29), S169 (= S167), Q171 (= Q169), R196 (= R194), D317 (= D323), K344 (= K350)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S24 (= S25), R28 (= R29), T98 (= T96), Q171 (= Q169), R196 (= R194), D317 (= D323), K344 (= K350)
4egrA 2.50 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with phosphoenolpyruvate
41% identity, 97% coverage: 7:437/443 of query aligns to 6:424/434 of 4egrA
- active site: K23 (= K24), S24 (= S25), D50 (= D51), N95 (= N93), R125 (= R123), D313 (= D323), E341 (= E351), H384 (= H397), R385 (= R398), T411 (= T424)
- binding phosphoenolpyruvate: K23 (= K24), G97 (= G95), T98 (= T96), R125 (= R123), D313 (= D323), E341 (= E351), R344 (= R354), R385 (= R398)
1rf6A Structural studies of streptococcus pneumoniae epsp synthase in s3p- glp bound state (see paper)
42% identity, 95% coverage: 14:436/443 of query aligns to 10:424/427 of 1rf6A
- active site: K20 (= K24), S21 (= S25), D47 (= D51), N90 (= N93), D115 (≠ Q118), R120 (= R123), D312 (= D323), E340 (= E351), H384 (= H397), R385 (= R398), T412 (= T424)
- binding glyphosate: K20 (= K24), G92 (= G95), T93 (= T96), R120 (= R123), Q168 (= Q169), D312 (= D323), E340 (= E351), R343 (= R354), H384 (= H397), R385 (= R398)
- binding shikimate-3-phosphate: S21 (= S25), R25 (= R29), S166 (= S167), Q168 (= Q169), R193 (= R194), I311 (= I322), D312 (= D323), K339 (= K350)
1rf4A Structural studies of streptococcus pneumoniae epsp synthase, tetrahedral intermediate bound state (see paper)
42% identity, 95% coverage: 14:436/443 of query aligns to 10:424/427 of 1rf4A
- active site: K20 (= K24), S21 (= S25), D47 (= D51), N90 (= N93), D115 (≠ Q118), R120 (= R123), D312 (= D323), E340 (= E351), H384 (= H397), R385 (= R398), T412 (= T424)
- binding (3r,4s,5r)-5-{[(1r)-1-carboxy-2-fluoro-1-(phosphonooxy)ethyl]oxy}-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K20 (= K24), S21 (= S25), R25 (= R29), G92 (= G95), T93 (= T96), R120 (= R123), S166 (= S167), A167 (= A168), Q168 (= Q169), R193 (= R194), D312 (= D323), K339 (= K350), E340 (= E351), R343 (= R354), H384 (= H397), R385 (= R398)
Q9S400 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) (see paper)
42% identity, 95% coverage: 14:436/443 of query aligns to 10:424/427 of Q9S400
3nvsA 1.02 angstrom resolution crystal structure of 3-phosphoshikimate 1- carboxyvinyltransferase from vibrio cholerae in complex with shikimate-3-phosphate (partially photolyzed) and glyphosate
30% identity, 97% coverage: 3:431/443 of query aligns to 1:419/426 of 3nvsA
- active site: K22 (= K24), S23 (= S25), D49 (= D51), N94 (= N93), P119 (≠ Q118), R124 (= R123), H128 (≠ R127), Q135 (≠ R134), Y142 (≠ G141), E144 (≠ D143), A247 (= A245), A255 (≠ L253), D314 (= D323), E342 (= E351), H386 (= H397), R387 (= R398), K412 (≠ T424)
- binding glyphosate: K22 (= K24), G96 (= G95), R124 (= R123), Q172 (= Q169), D314 (= D323), E342 (= E351), R345 (= R354), H386 (= H397), R387 (= R398)
- binding magnesium ion: E123 (≠ G122), Q145 (≠ K144)
- binding shikimate-3-phosphate: K22 (= K24), S23 (= S25), R27 (= R29), T97 (= T96), S170 (= S167), S171 (≠ A168), Q172 (= Q169), S198 (≠ P190), Y201 (≠ T193), D314 (= D323), N337 (≠ E346), K341 (= K350)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S23 (= S25), R27 (= R29), Q172 (= Q169), Y201 (≠ T193), D314 (= D323), K341 (= K350)
Q9KRB0 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
30% identity, 97% coverage: 3:431/443 of query aligns to 1:419/426 of Q9KRB0
P11043 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EC 2.5.1.19 from Petunia hybrida (Petunia) (see paper)
31% identity, 96% coverage: 10:434/443 of query aligns to 81:511/516 of P11043
- G173 (= G95) mutation to A: Resistance to glyphosate due to a lower affinity. Slight reduction in EPSP synthase activity.
6hqvA Pentafunctional arom complex from chaetomium thermophilum (see paper)
30% identity, 94% coverage: 18:433/443 of query aligns to 402:824/1555 of 6hqvA
Sites not aligning to the query:
- active site: 123, 145, 187, 243, 253, 257, 261, 264, 268, 280
- binding (4S,5R)-4,5-dihydroxy-3-oxocyclohex-1-ene-1-carboxylic acid: 1060, 1062, 1181, 1224, 1232, 1242, 1243
- binding glutamic acid: 139, 145, 187, 243, 257, 264, 280
- binding nicotinamide-adenine-dinucleotide: 42, 44, 45, 76, 79, 107, 108, 109, 112, 132, 133, 135, 139, 140, 145, 154, 175, 176, 177, 180, 280
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: 874, 923, 924, 979, 1277, 1279, 1323, 1327, 1348, 1368, 1526
- binding zinc ion: 187, 264, 280
P07547 Pentafunctional AROM polypeptide; EC 4.2.3.4; EC 2.5.1.19; EC 2.7.1.71; EC 4.2.1.10; EC 1.1.1.25 from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) (see 2 papers)
27% identity, 95% coverage: 17:436/443 of query aligns to 408:839/1583 of P07547
Sites not aligning to the query:
- 44:46 binding
- 81:84 binding
- 114:116 binding
- 119 binding
- 139:140 binding
- 161 binding
- 179:182 binding
- 190 binding
- 194 binding
- 271 binding
- 287 binding
7tm5B Crystal structure of shikimate-3-phosphate bound 3-phosphoshikimate 1- carboxyvinyltransferase from klebsiella pneumoniae
30% identity, 96% coverage: 3:429/443 of query aligns to 1:416/427 of 7tm5B
- binding shikimate-3-phosphate: K22 (= K24), S23 (= S25), R27 (= R29), S169 (= S167), S170 (≠ A168), Q171 (= Q169), S197 (≠ R194), Y200 (vs. gap), D313 (= D323), N336 (≠ E346), K340 (= K350)
7tm6A Crystal structure of shikimate-3-phosphate and glyphosate bound 3- phosphoshikimate 1-carboxyvinyltransferase from klebsiella pneumoniae
30% identity, 96% coverage: 6:429/443 of query aligns to 3:415/426 of 7tm6A
- binding glyphosate: K21 (= K24), G95 (= G95), R123 (= R123), Q170 (= Q169), D312 (= D323), E340 (= E351), R343 (= R354), H384 (= H397), R385 (= R398)
- binding shikimate-3-phosphate: S22 (= S25), R26 (= R29), T96 (= T96), S168 (= S167), S169 (≠ A168), Q170 (= Q169), S196 (≠ R194), Y199 (vs. gap), D312 (= D323), N335 (≠ E346), K339 (= K350)
7m0oA Dgt-28 epsps (see paper)
32% identity, 94% coverage: 21:435/443 of query aligns to 3:400/400 of 7m0oA
2pq9A E. Coli epsps liganded with (r)-difluoromethyl tetrahedral reaction intermediate analog (see paper)
29% identity, 96% coverage: 3:429/443 of query aligns to 1:416/427 of 2pq9A
- active site: K22 (= K24), S23 (= S25), D49 (= D51), N94 (= N93), P119 (≠ Q118), R124 (= R123), D313 (= D323), E341 (= E351), H385 (= H397), R386 (= R398), K411 (≠ T424)
- binding (3r,4s,5r)-5-[(1r)-1-carboxy-2,2-difluoro-1-(phosphonooxy)ethoxy]-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K22 (= K24), S23 (= S25), R27 (= R29), G96 (= G95), T97 (= T96), R124 (= R123), S169 (= S167), S170 (≠ A168), Q171 (= Q169), S197 (≠ R194), Y200 (vs. gap), D313 (= D323), N336 (≠ E346), K340 (= K350), R344 (= R354), H385 (= H397), R386 (= R398), K411 (≠ T424)
Query Sequence
>CCNA_03704 FitnessBrowser__Caulo:CCNA_03704
MSLAGLKSAPGGALRGIVRAPGDKSISHRSMILGALATGTTTVEGLLEGDDVLATARAMQ
AFGARIEREGVGRWRIEGKGGFEEPVDVIDCGNAGTGVRLIMGAAAGFAMCATFTGDQSL
RGRPMGRVLDPLARMGATWLGRDKGRLPLTLKGGNLRGLNYTLPMASAQVKSAVLLAGLH
AEGGVEVIEPEATRDHTERMLRAFGAEVIVEDRKAGDKTFRHVRLPEGQKLTGTHVAVPG
DPSSAAFPLVAALIVPGSEVTVEGVMLNELRTGLFTTLQEMGADLVISNVRVASGEEVGD
ITARYSQLKGVVVPPERAPSMIDEYPILAVAAAFASGETVMRGVGEMRVKESDRISLTAN
GLKACGVQVVEEPEGFIVTGTGQPPKGGATVVTHGDHRIAMSHLILGMAAQAEVAVDEPG
MIATSFPGFADLMRGLGATLAEA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory