Comparing CCNA_03714 FitnessBrowser__Caulo:CCNA_03714 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
55% identity, 93% coverage: 11:245/252 of query aligns to 3:238/240 of 6mjpA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
52% identity, 97% coverage: 2:245/252 of query aligns to 2:238/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
52% identity, 97% coverage: 2:245/252 of query aligns to 2:238/238 of 6s8gA
6mbnA Lptb e163q in complex with atp (see paper)
51% identity, 97% coverage: 2:245/252 of query aligns to 3:239/241 of 6mbnA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
52% identity, 96% coverage: 2:242/252 of query aligns to 2:235/235 of 6mhzA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
51% identity, 95% coverage: 2:241/252 of query aligns to 2:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
51% identity, 95% coverage: 2:241/252 of query aligns to 2:234/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
51% identity, 95% coverage: 2:240/252 of query aligns to 2:233/233 of 6b8bA
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
32% identity, 92% coverage: 11:242/252 of query aligns to 7:238/240 of 1ji0A
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
34% identity, 88% coverage: 9:230/252 of query aligns to 3:223/285 of 4yerA
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
30% identity, 94% coverage: 8:243/252 of query aligns to 2:254/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
30% identity, 93% coverage: 8:242/252 of query aligns to 2:253/253 of 1g9xB
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
30% identity, 87% coverage: 11:230/252 of query aligns to 2:223/240 of 4ymuJ
3c4jA Abc protein artp in complex with atp-gamma-s
31% identity, 92% coverage: 13:245/252 of query aligns to 6:242/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
31% identity, 92% coverage: 13:245/252 of query aligns to 6:242/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
31% identity, 92% coverage: 13:245/252 of query aligns to 6:242/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
31% identity, 92% coverage: 13:245/252 of query aligns to 6:242/242 of 2oljA
3d31A Modbc from methanosarcina acetivorans (see paper)
33% identity, 84% coverage: 28:239/252 of query aligns to 18:224/348 of 3d31A
Sites not aligning to the query:
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
32% identity, 89% coverage: 21:244/252 of query aligns to 13:242/253 of 6z5uK
Sites not aligning to the query:
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
32% identity, 89% coverage: 21:244/252 of query aligns to 15:244/263 of 7d0aB
>CCNA_03714 FitnessBrowser__Caulo:CCNA_03714
MTLTSKDMDGLFVDSVGKSFGDRPVVKNVSLRLKRGEVAGLLGPNGAGKTTCFYMVTGLI
AADYGAIYLDGENITAQPMFQRARLGVGYLPQEASIFRGMTVEQNVMAVVEMRERDPRKA
REQVTSILEELRITHIRKSPAVALSGGERRRVEIARALASEPSFMLLDEPFAGIDPLAIA
DIREVIGYLKGRGIGILITDHNVRETLDIIDRASIIHAGEVLFEGSPREIVENPEVKRVY
LGESFTEPRLGD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory