Comparing CCNA_03746 CCNA_03746 acetylornithine deacetylase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7rsfA Acetylornithine deacetylase from escherichia coli
34% identity, 92% coverage: 11:371/391 of query aligns to 10:359/380 of 7rsfA
Q8P8J5 N-acetyl-L-citrulline deacetylase; ACDase; Acetylcitrulline deacetylase; EC 3.5.1.- from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
30% identity, 97% coverage: 8:387/391 of query aligns to 4:363/366 of Q8P8J5
2f7vA Structure of acetylcitrulline deacetylase complexed with one co (see paper)
29% identity, 97% coverage: 8:387/391 of query aligns to 5:358/360 of 2f7vA
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
32% identity, 50% coverage: 73:266/391 of query aligns to 62:258/376 of 4o23A
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
32% identity, 50% coverage: 73:266/391 of query aligns to 62:258/375 of 4pqaA
Sites not aligning to the query:
7uoiA Crystallographic structure of dape from enterococcus faecium
26% identity, 86% coverage: 36:372/391 of query aligns to 33:364/383 of 7uoiA
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
29% identity, 53% coverage: 60:266/391 of query aligns to 54:262/380 of 5vo3A
Sites not aligning to the query:
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
29% identity, 53% coverage: 60:266/391 of query aligns to 50:258/377 of P44514
Sites not aligning to the query:
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
25% identity, 73% coverage: 32:317/391 of query aligns to 33:320/408 of Q03154
Sites not aligning to the query:
7lgpB Dape enzyme from shigella flexneri
29% identity, 50% coverage: 73:266/391 of query aligns to 63:259/377 of 7lgpB
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
29% identity, 51% coverage: 73:272/391 of query aligns to 75:281/407 of P37111
Sites not aligning to the query:
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
28% identity, 54% coverage: 56:267/391 of query aligns to 46:261/377 of 7t1qA
Sites not aligning to the query:
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
36% identity, 29% coverage: 60:172/391 of query aligns to 52:167/258 of 4h2kA
Sites not aligning to the query:
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
30% identity, 48% coverage: 73:259/391 of query aligns to 99:286/426 of 3pfoA
Sites not aligning to the query:
3dljA Crystal structure of human carnosine dipeptidase 1
38% identity, 22% coverage: 70:154/391 of query aligns to 93:180/471 of 3dljA
Sites not aligning to the query:
Q96KN2 Beta-Ala-His dipeptidase; CNDP dipeptidase 1; Carnosine dipeptidase 1; Glutamate carboxypeptidase-like protein 2; Serum carnosinase; EC 3.4.13.20 from Homo sapiens (Human) (see 4 papers)
38% identity, 22% coverage: 70:154/391 of query aligns to 124:211/507 of Q96KN2
Sites not aligning to the query:
2pokA Crystal structure of a m20 family metallo peptidase from streptococcus pneumoniae
40% identity, 17% coverage: 73:138/391 of query aligns to 86:152/458 of 2pokA
Sites not aligning to the query:
Q96KP4 Cytosolic non-specific dipeptidase; CNDP dipeptidase 2; Glutamate carboxypeptidase-like protein 1; Peptidase A; Threonyl dipeptidase; EC 3.4.13.18 from Homo sapiens (Human)
40% identity, 21% coverage: 73:153/391 of query aligns to 94:177/475 of Q96KP4
Sites not aligning to the query:
2zogA Crystal structure of mouse carnosinase cn2 complexed with zn and bestatin (see paper)
40% identity, 21% coverage: 73:153/391 of query aligns to 98:181/478 of 2zogA
Sites not aligning to the query:
2zofA Crystal structure of mouse carnosinase cn2 complexed with mn and bestatin (see paper)
40% identity, 21% coverage: 73:153/391 of query aligns to 98:181/478 of 2zofA
Sites not aligning to the query:
>CCNA_03746 CCNA_03746 acetylornithine deacetylase
MVASSEALSARAIDILAKLVAFDTTSRRSNLALIEWVEQYLAELNVPTRRVPNADGTKSN
LMAMIGPAVEGGVVLSGHTDVVPVDGQPWSTDPWTLTERDGRLYGRGTCDMKGFLALALA
AAPDLAQANLRKPVHLAFSYDEEVGCLGAPDMIDVIAREVPRPALVVVGEPTDMVAVRAH
KGIASFKVTVTGREAHSSLTHLGVSANMVAIKLMAMLVGLSEKLEREADPNSPFTPKGAT
LTIGQVNGGTAVNILARECVFIFDLRTPAGMDPVALLSDFFAMASALDAQIKAKAPEGGV
KVERRSLTPAFAPEEDGVAEAFARKLAGDNGPARVVPYAAEAGQFQGAGFSTVICGPGSI
DQAHQPNEYVEISQMQRGGAFMRRLVEDLST
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory