SitesBLAST
Comparing CCNA_03750 FitnessBrowser__Caulo:CCNA_03750 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
A4F2N8 L-threo-3-hydroxyaspartate ammonia-lyase; L-threo-3-hydroxyaspartate dehydratase; L-THA DH; EC 4.3.1.16 from Pseudomonas sp. (see paper)
40% identity, 76% coverage: 11:314/400 of query aligns to 12:317/319 of A4F2N8
- K53 (= K52) mutation to A: Loss of enzymatic activity.
Q7XSN8 Serine racemase; D-serine dehydratase; D-serine ammonia-lyase; L-serine dehydratase; L-serine ammonia-lyase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Oryza sativa subsp. japonica (Rice) (see paper)
34% identity, 78% coverage: 4:316/400 of query aligns to 20:338/339 of Q7XSN8
- E219 (= E203) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-225.
- D225 (≠ P208) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-219.
2gn2A Crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form) (see paper)
40% identity, 77% coverage: 8:313/400 of query aligns to 12:321/326 of 2gn2A
- active site: K56 (= K52), A81 (= A77), Q207 (≠ E203), V211 (≠ Y207), G213 (≠ S209), G235 (= G229), I308 (≠ L300), S309 (≠ C301)
- binding cytidine-5'-monophosphate: R51 (≠ F47), T52 (= T48), G53 (≠ A49), A114 (≠ H110), D117 (= D113), Y118 (≠ F114), N312 (= N304)
O59791 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 4.3.1.17; EC 4.3.1.18; EC 5.1.1.18 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
35% identity, 77% coverage: 8:316/400 of query aligns to 13:323/323 of O59791
- S82 (≠ A77) mutation to A: Loss of racemase activity. Reduces D-serine dehydratase activity by 99%. Slightly reduced L-serine dehydratase activity.
1wtcA Crystal structure of s.Pombe serine racemase complex with amppcp (see paper)
35% identity, 77% coverage: 8:316/400 of query aligns to 8:318/318 of 1wtcA
- active site: K52 (= K52), S77 (≠ A77), E203 (= E203), G207 (≠ Y207), D209 (≠ S209), G231 (= G229), I302 (≠ L300), S303 (≠ C301)
- binding phosphomethylphosphonic acid adenylate ester: N20 (≠ E20), K47 (≠ F47), M48 (≠ T48), A109 (≠ Q109), A110 (≠ H110), Y114 (≠ F114)
- binding magnesium ion: E203 (= E203), G207 (≠ Y207), D209 (≠ S209)
- binding pyridoxal-5'-phosphate: F51 (≠ Y51), K52 (= K52), N79 (= N79), G178 (= G178), G179 (= G179), G180 (= G180), G181 (= G181), G231 (= G229), E276 (= E274), T278 (≠ A276), S303 (≠ C301)
1v71A Crystal structure of s.Pombe serine racemase
35% identity, 77% coverage: 8:316/400 of query aligns to 8:318/318 of 1v71A
- active site: K52 (= K52), S77 (≠ A77), E203 (= E203), G207 (≠ Y207), D209 (≠ S209), G231 (= G229), I302 (≠ L300), S303 (≠ C301)
- binding magnesium ion: E203 (= E203), G207 (≠ Y207), D209 (≠ S209)
- binding pyridoxal-5'-phosphate: F51 (≠ Y51), K52 (= K52), N79 (= N79), G178 (= G178), G179 (= G179), G180 (= G180), G181 (= G181), G231 (= G229), E276 (= E274), T278 (≠ A276), S303 (≠ C301), G304 (= G302)
2zr8A Crystal structure of modified serine racemase complexed with serine (see paper)
35% identity, 77% coverage: 8:316/400 of query aligns to 9:319/319 of 2zr8A
- active site: K53 (= K52), S78 (≠ A77), E204 (= E203), G208 (≠ Y207), D210 (≠ S209), G232 (= G229), I303 (≠ L300), S304 (≠ C301)
- binding magnesium ion: E204 (= E203), G208 (≠ Y207), D210 (≠ S209)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (≠ Y51), K53 (= K52), S77 (= S76), S78 (≠ A77), N80 (= N79), H81 (= H80), P147 (= P146), G179 (= G178), G180 (= G179), G181 (= G180), G182 (= G181), G232 (= G229), E277 (= E274), T279 (≠ A276), S304 (≠ C301)
- binding serine: S78 (≠ A77), R129 (≠ A128), D231 (≠ E228), G232 (= G229), A233 (≠ V230), Q234 (≠ A231), T235 (≠ V232)
2zpuA Crystal structure of modified serine racemase from s.Pombe. (see paper)
35% identity, 77% coverage: 8:316/400 of query aligns to 9:319/319 of 2zpuA
- active site: K53 (= K52), S78 (≠ A77), E204 (= E203), G208 (≠ Y207), D210 (≠ S209), G232 (= G229), I303 (≠ L300), S304 (≠ C301)
- binding magnesium ion: E204 (= E203), G208 (≠ Y207), D210 (≠ S209)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (≠ Y51), K53 (= K52), S77 (= S76), S78 (≠ A77), N80 (= N79), H81 (= H80), P147 (= P146), G179 (= G178), G180 (= G179), G181 (= G180), G182 (= G181), G232 (= G229), E277 (= E274), T279 (≠ A276), S304 (≠ C301)
1tdjA Threonine deaminase (biosynthetic) from e. Coli (see paper)
35% identity, 94% coverage: 22:395/400 of query aligns to 28:400/494 of 1tdjA
- active site: K58 (= K52), A83 (= A77), E209 (= E203), S213 (≠ Y207), C215 (≠ S209), G237 (= G229), L310 (= L300), S311 (≠ C301)
- binding pyridoxal-5'-phosphate: F57 (≠ Y51), K58 (= K52), N85 (= N79), G184 (= G178), G185 (= G179), G186 (= G180), G187 (= G181), G237 (= G229), E282 (= E274), S311 (≠ C301), G312 (= G302)
P04968 L-threonine dehydratase biosynthetic IlvA; Threonine deaminase; EC 4.3.1.19 from Escherichia coli (strain K12) (see paper)
35% identity, 94% coverage: 22:395/400 of query aligns to 32:404/514 of P04968
- K62 (= K52) modified: N6-(pyridoxal phosphate)lysine
- N89 (= N79) binding
- GGGGL 188:192 (= GGGGL 178:182) binding
- S315 (≠ C301) binding
7nbgDDD structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
32% identity, 76% coverage: 3:306/400 of query aligns to 4:310/310 of 7nbgDDD
- active site: K53 (= K52), S76 (≠ A77), E202 (= E203), A206 (≠ Y207), D208 (≠ S209), G231 (= G229), L304 (= L300), S305 (≠ C301)
- binding calcium ion: E202 (= E203), A206 (≠ Y207), D208 (≠ S209)
- binding magnesium ion: N239 (≠ L238)
- binding ortho-xylene: S76 (≠ A77), Q81 (= Q82), I96 (= I97), Y113 (≠ F114)
- binding pyridoxal-5'-phosphate: F52 (≠ Y51), K53 (= K52), N78 (= N79), G177 (= G178), G178 (= G179), G179 (= G180), G180 (= G181), M181 (≠ L182), G231 (= G229), V232 (= V230), E275 (= E274), T277 (≠ A276), S305 (≠ C301), G306 (= G302)
Sites not aligning to the query:
3l6bA X-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor (see paper)
32% identity, 76% coverage: 3:306/400 of query aligns to 5:311/322 of 3l6bA
- active site: K54 (= K52), S77 (≠ A77), E203 (= E203), A207 (≠ Y207), D209 (≠ S209), G232 (= G229), T278 (≠ A276), L305 (= L300), S306 (≠ C301)
- binding malonate ion: K54 (= K52), S76 (= S76), S77 (≠ A77), N79 (= N79), H80 (= H80), R128 (≠ A128), G232 (= G229)
- binding manganese (ii) ion: E203 (= E203), A207 (≠ Y207), D209 (≠ S209)
- binding pyridoxal-5'-phosphate: F53 (≠ Y51), K54 (= K52), N79 (= N79), G178 (= G178), G179 (= G179), G180 (= G180), G181 (= G181), M182 (≠ L182), V233 (= V230), E276 (= E274), T278 (≠ A276), S306 (≠ C301), G307 (= G302)
5cvcA Structure of maize serine racemase (see paper)
33% identity, 79% coverage: 4:318/400 of query aligns to 4:324/329 of 5cvcA
- active site: K52 (= K52), S77 (≠ A77), E203 (= E203), A207 (≠ M206), D209 (≠ P208), G231 (= G229), V306 (≠ L300), S307 (≠ C301)
- binding magnesium ion: E203 (= E203), A207 (≠ M206), D209 (≠ P208)
- binding pyridoxal-5'-phosphate: F51 (≠ Y51), K52 (= K52), N79 (= N79), S178 (≠ G178), G179 (= G179), G180 (= G180), G181 (= G181), L232 (≠ V230), E275 (= E274), S307 (≠ C301), G308 (= G302)
6zspAAA serine racemase bound to atp and malonate. (see paper)
32% identity, 76% coverage: 3:306/400 of query aligns to 4:308/320 of 6zspAAA
- active site: K53 (= K52), S74 (≠ A77), E200 (= E203), A204 (≠ Y207), D206 (≠ S209), G229 (= G229), L302 (= L300), S303 (≠ C301)
- binding adenosine-5'-triphosphate: S28 (= S27), S29 (≠ K28), I30 (≠ T29), K48 (≠ F47), T49 (= T48), Q79 (= Q82), Y111 (≠ F114), E266 (≠ N267), R267 (≠ V268), K269 (= K270), N306 (= N304)
- binding magnesium ion: E200 (= E203), A204 (≠ Y207), D206 (≠ S209)
- binding malonate ion: K53 (= K52), S73 (= S76), S74 (≠ A77), N76 (= N79), H77 (= H80), R125 (≠ A128), G229 (= G229), S232 (≠ K233)
7nbfAAA structure of human serine racemase in complex with DSiP fragment Z126932614, XChem fragment screen (see paper)
32% identity, 76% coverage: 3:306/400 of query aligns to 4:315/323 of 7nbfAAA
- active site: K53 (= K52), S81 (≠ A77), E207 (= E203), A211 (≠ Y207), D213 (≠ S209), G236 (= G229), L309 (= L300), S310 (≠ C301)
- binding calcium ion: E207 (= E203), A211 (≠ Y207), D213 (≠ S209)
- binding magnesium ion: N244 (≠ L238)
- binding pyridoxal-5'-phosphate: F52 (≠ Y51), K53 (= K52), N83 (= N79), G182 (= G178), G183 (= G179), G184 (= G180), G185 (= G181), M186 (≠ L182), G236 (= G229), V237 (= V230), T282 (≠ A276), S310 (≠ C301), G311 (= G302)
- binding 2-[(methylsulfonyl)methyl]-1H-benzimidazole: H21 (≠ E20), L22 (≠ R21), T23 (= T22), P24 (= P23), L26 (≠ R25), T27 (≠ H26), F46 (≠ L45)
Sites not aligning to the query:
7nbdAAA structure of human serine racemase in complex with DSiP fragment Z235449082, XChem fragment screen (see paper)
32% identity, 76% coverage: 3:306/400 of query aligns to 4:315/323 of 7nbdAAA
- active site: K53 (= K52), S81 (≠ A77), E207 (= E203), A211 (≠ Y207), D213 (≠ S209), G236 (= G229), L309 (= L300), S310 (≠ C301)
- binding calcium ion: E207 (= E203), A211 (≠ Y207), D213 (≠ S209)
- binding [4-(1H-benzimidazol-1-yl)phenyl]methanol: W272 (≠ C266), L278 (≠ I272), V314 (≠ I305)
- binding magnesium ion: N244 (≠ L238)
- binding pyridoxal-5'-phosphate: F52 (≠ Y51), K53 (= K52), N83 (= N79), G182 (= G178), G183 (= G179), G184 (= G180), G185 (= G181), M186 (≠ L182), G236 (= G229), V237 (= V230), E280 (= E274), T282 (≠ A276), S310 (≠ C301), G311 (= G302)
Sites not aligning to the query:
7nbcCCC structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
32% identity, 76% coverage: 3:306/400 of query aligns to 4:315/323 of 7nbcCCC
- active site: K53 (= K52), S81 (≠ A77), E207 (= E203), A211 (≠ Y207), D213 (≠ S209), G236 (= G229), L309 (= L300), S310 (≠ C301)
- binding biphenyl-4-ylacetic acid: T78 (≠ A74), H79 (≠ A75), H84 (= H80), V148 (= V144), H149 (= H145), P150 (= P146)
- binding calcium ion: E207 (= E203), A211 (≠ Y207), D213 (≠ S209)
- binding pyridoxal-5'-phosphate: F52 (≠ Y51), K53 (= K52), N83 (= N79), G182 (= G178), G183 (= G179), G184 (= G180), G185 (= G181), M186 (≠ L182), G236 (= G229), V237 (= V230), T282 (≠ A276), S310 (≠ C301), G311 (= G302)
7nbcAAA structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
32% identity, 76% coverage: 3:306/400 of query aligns to 4:315/323 of 7nbcAAA
- active site: K53 (= K52), S81 (≠ A77), E207 (= E203), A211 (≠ Y207), D213 (≠ S209), G236 (= G229), L309 (= L300), S310 (≠ C301)
- binding calcium ion: E207 (= E203), A211 (≠ Y207), D213 (≠ S209)
- binding magnesium ion: N244 (≠ L238)
- binding pyridoxal-5'-phosphate: F52 (≠ Y51), K53 (= K52), N83 (= N79), G182 (= G178), G183 (= G179), G184 (= G180), G185 (= G181), M186 (≠ L182), G236 (= G229), V237 (= V230), T282 (≠ A276), S310 (≠ C301), G311 (= G302)
Sites not aligning to the query:
7nbhAAA structure of human serine racemase in complex with DSiP fragment Z26781964, XChem fragment screen (see paper)
32% identity, 76% coverage: 3:306/400 of query aligns to 4:315/320 of 7nbhAAA
- active site: K53 (= K52), S81 (≠ A77), E207 (= E203), A211 (≠ Y207), D213 (≠ S209), G236 (= G229), L309 (= L300), S310 (≠ C301)
- binding calcium ion: E207 (= E203), A211 (≠ Y207), D213 (≠ S209)
- binding N-[(1H-benzimidazol-2-yl)methyl]furan-2-carboxamide: S81 (≠ A77), G85 (≠ A81), Q86 (= Q82), K111 (= K107), I115 (≠ T111), Y118 (≠ F114), D235 (≠ E228), P281 (≠ G275), N313 (= N304), V314 (≠ I305), D315 (= D306)
7nbgAAA structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
32% identity, 76% coverage: 3:306/400 of query aligns to 4:315/322 of 7nbgAAA
- active site: K53 (= K52), S81 (≠ A77), E207 (= E203), A211 (≠ Y207), D213 (≠ S209), G236 (= G229), L309 (= L300), S310 (≠ C301)
- binding calcium ion: E207 (= E203), A211 (≠ Y207), D213 (≠ S209)
- binding pyridoxal-5'-phosphate: F52 (≠ Y51), K53 (= K52), N83 (= N79), G182 (= G178), G183 (= G179), G184 (= G180), G185 (= G181), M186 (≠ L182), G236 (= G229), V237 (= V230), T282 (≠ A276), S310 (≠ C301), G311 (= G302)
- binding ~{N}-[2-(2-methylphenyl)ethyl]ethanamide: S81 (≠ A77), G85 (≠ A81), Q86 (= Q82), I101 (= I97), K111 (= K107), I115 (≠ T111), Y118 (≠ F114)
Query Sequence
>CCNA_03750 FitnessBrowser__Caulo:CCNA_03750
MTLDLAAIQAAAGRLQGQIERTPCRHSKTLSKITGAEVWVKFENLQFTAAYKERGALNKL
MLLSETEKQRGVIAASAGNHAQGLAYHGARLGVPVTIVMPKTTPFVKVQHTRDFGATVVI
EGETYDDANAHARKLRDEQGLTFVHPFDDYDIMAGQGTIALEMLEDAPDLEILPVPIGGG
GLISGVATAAKALKPDIRIIGCEPAMYPSFTAKMRGVAAHCGGQTIAEGVAVKQVGELTY
GVVRPLLDDVLLLEEPYLEQAVSLYCNVEKTIAEGAGAASLAALLAYPERFRGKKCGLIL
CGGNIDTRLLASVLTRELVRAQRLASLRIIGDDRPGLLSTVASVIGAMGANIIEVNHNRL
ALDVPAKGAEFDITIETRDAQHTQEVMEALRESGYPPRVV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory