Comparing CCNA_03757 CCNA_03757 citrate synthase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P39119 Citrate synthase 1; Citrate synthase I; EC 2.3.3.16 from Bacillus subtilis (strain 168) (see paper)
37% identity, 97% coverage: 4:354/361 of query aligns to 5:358/366 of P39119
2c6xA Structure of bacillus subtilis citrate synthase
37% identity, 97% coverage: 4:354/361 of query aligns to 4:357/363 of 2c6xA
6abxA Crystal structure of citrate synthase (msed_1522) from metallosphaera sedula in complex with citrate (see paper)
36% identity, 97% coverage: 4:354/361 of query aligns to 6:358/370 of 6abxA
6abyA Crystal structure of citrate synthase (msed_1522) from metallosphaera sedula in complex with oxaloacetate (see paper)
36% identity, 97% coverage: 4:354/361 of query aligns to 6:358/372 of 6abyA
1aj8A Citrate synthase from pyrococcus furiosus (see paper)
33% identity, 98% coverage: 1:354/361 of query aligns to 1:358/371 of 1aj8A
8gi7A C143a variant of citrate synthase (cita) in mycobacterium tuberculosis (see paper)
41% identity, 98% coverage: 4:355/361 of query aligns to 8:352/368 of 8gi7A
8glbD Selenomethionine derivatized citrate synthase (cita) in mycobacterium tuberculosis with pyruvate (see paper)
40% identity, 98% coverage: 4:355/361 of query aligns to 11:355/374 of 8glbD
8gmiA Citrate synthase (cita) in mycobacterium tuberculosis modified by ebselen at c143 residue (see paper)
40% identity, 98% coverage: 4:355/361 of query aligns to 10:354/369 of 8gmiA
1iomA Crystal structure of citrate synthase from thermus thermophilus hb8 (see paper)
36% identity, 97% coverage: 4:354/361 of query aligns to 4:362/374 of 1iomA
1ixeA Crystal structure of citrate synthase from thermus thermophilus hb8 (see paper)
36% identity, 97% coverage: 4:354/361 of query aligns to 4:359/371 of 1ixeA
6abwA Crystal structure of citrate synthase (msed_0281) from metallosphaera sedula in complex with acetyl-coa (see paper)
35% identity, 97% coverage: 6:355/361 of query aligns to 1:358/369 of 6abwA
I6Y9Q3 2-methylcitrate synthase; 2-MCS; MCS; Citrate synthase; EC 2.3.3.5; EC 2.3.3.16 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
36% identity, 99% coverage: 1:359/361 of query aligns to 28:388/393 of I6Y9Q3
P39120 Citrate synthase 2; Citrate synthase II; EC 2.3.3.16 from Bacillus subtilis (strain 168) (see paper)
34% identity, 98% coverage: 4:356/361 of query aligns to 6:361/372 of P39120
6s87D Crystal structure of 2-methylcitrate synthase (prpc) from pseudomonas aeruginosa in complex with oxaloacetate.
32% identity, 98% coverage: 4:358/361 of query aligns to 1:357/365 of 6s87D
P9WPD5 Citrate synthase 1; EC 2.3.3.16 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
32% identity, 98% coverage: 4:358/361 of query aligns to 48:423/431 of P9WPD5
O34002 2-methylcitrate synthase; 2-MCS; MCS; Citrate synthase; EC 2.3.3.5; EC 2.3.3.16 from Antarctic bacterium DS2-3R (see 2 papers)
33% identity, 99% coverage: 1:358/361 of query aligns to 6:376/379 of O34002
Sites not aligning to the query:
1a59A Cold-active citrate synthase (see paper)
33% identity, 99% coverage: 1:358/361 of query aligns to 4:374/377 of 1a59A
4jagA Structural determination of the a50t:s279g:s280k:v281k:k282e:h283n variant of citrate synthase from e. Coli complexed with oxaloacetate (see paper)
30% identity, 98% coverage: 4:358/361 of query aligns to 45:418/426 of 4jagA
4jaeA Structural determination of the a50t:s279g:s280k:v281k:k282e:h283n variant of citrate synthase from e. Coli complexed with s- carboxymethyl-coa (see paper)
30% identity, 98% coverage: 4:358/361 of query aligns to 45:418/426 of 4jaeA
2h12B Structure of acetobacter aceti citrate synthase complexed with oxaloacetate and carboxymethyldethia coenzyme a (cmx) (see paper)
31% identity, 96% coverage: 10:354/361 of query aligns to 49:414/426 of 2h12B
>CCNA_03757 CCNA_03757 citrate synthase
MSDGLEGVIAAQTVLSDVDGAHGRLVIRGYAVEDLAGRTRFEDAAHLLLDGFFDDAPSDL
SSALGEARVGVFAEVAALDEGLARRDPVEALRALLARIPDGDDLKTALRLIAAPAVFTPA
VLRVANGDAPIAPDPALSHAADILRMIRGVPATDAEAAALDAYLVTVCDHGLNASTFAAR
VVASTRAGLTSAVLAGLSALKGPLHGGAPGPVIDMLDAIGTPENARPWLERALARGDRLM
GFGHRIYRVRDPRADALKAAVRRLSSASGGLPGRLAFAEAVERAALEILREHKPDRPLDT
NVEFYTALLLEALGLPPSSFTCVFAMGRVAGWLAHAREQLAGGRLIRPQSVYVGPEVRVA
A
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory