Comparing CCNA_03758 FitnessBrowser__Caulo:CCNA_03758 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P39120 Citrate synthase 2; Citrate synthase II; EC 2.3.3.16 from Bacillus subtilis (strain 168) (see paper)
37% identity, 47% coverage: 204:388/392 of query aligns to 174:367/372 of P39120
6abxA Crystal structure of citrate synthase (msed_1522) from metallosphaera sedula in complex with citrate (see paper)
40% identity, 44% coverage: 206:378/392 of query aligns to 172:358/370 of 6abxA
6abyA Crystal structure of citrate synthase (msed_1522) from metallosphaera sedula in complex with oxaloacetate (see paper)
40% identity, 44% coverage: 206:378/392 of query aligns to 172:358/372 of 6abyA
8gi7A C143a variant of citrate synthase (cita) in mycobacterium tuberculosis (see paper)
33% identity, 76% coverage: 85:381/392 of query aligns to 25:354/368 of 8gi7A
8glbD Selenomethionine derivatized citrate synthase (cita) in mycobacterium tuberculosis with pyruvate (see paper)
33% identity, 76% coverage: 85:381/392 of query aligns to 28:357/374 of 8glbD
8gmiA Citrate synthase (cita) in mycobacterium tuberculosis modified by ebselen at c143 residue (see paper)
33% identity, 76% coverage: 85:381/392 of query aligns to 27:356/369 of 8gmiA
2c6xA Structure of bacillus subtilis citrate synthase
32% identity, 45% coverage: 207:382/392 of query aligns to 171:361/363 of 2c6xA
P39119 Citrate synthase 1; Citrate synthase I; EC 2.3.3.16 from Bacillus subtilis (strain 168) (see paper)
32% identity, 45% coverage: 207:382/392 of query aligns to 172:362/366 of P39119
1aj8A Citrate synthase from pyrococcus furiosus (see paper)
33% identity, 45% coverage: 206:380/392 of query aligns to 176:360/371 of 1aj8A
6abwA Crystal structure of citrate synthase (msed_0281) from metallosphaera sedula in complex with acetyl-coa (see paper)
37% identity, 44% coverage: 206:378/392 of query aligns to 168:357/369 of 6abwA
6s87D Crystal structure of 2-methylcitrate synthase (prpc) from pseudomonas aeruginosa in complex with oxaloacetate.
32% identity, 45% coverage: 202:379/392 of query aligns to 166:354/365 of 6s87D
4yboB Structure of citrate synthase from the thermoacidophilic euryarchaeon thermolasma acidophilum (see paper)
35% identity, 49% coverage: 196:388/392 of query aligns to 167:376/381 of 4yboB
2ifcC The structure of the binary complex of oxalateacetate with citrate synthase from the thermophilic archaeon thermolasma acidophilum
35% identity, 49% coverage: 196:388/392 of query aligns to 168:377/382 of 2ifcC
2r9eA The structure of the binary complex of citryl dethia coa and citrate synthase from the thermophilic archaeonthermoplasma acidophilum
35% identity, 49% coverage: 196:388/392 of query aligns to 168:377/381 of 2r9eA
2r26A The structure of the ternary complex of carboxymethyl coenzyme a and oxalateacetate with citrate synthase from the thermophilic archaeonthermoplasma acidophilum
35% identity, 49% coverage: 196:388/392 of query aligns to 168:377/381 of 2r26A
1a59A Cold-active citrate synthase (see paper)
34% identity, 44% coverage: 206:378/392 of query aligns to 178:370/377 of 1a59A
O34002 2-methylcitrate synthase; 2-MCS; MCS; Citrate synthase; EC 2.3.3.5; EC 2.3.3.16 from Antarctic bacterium DS2-3R (see 2 papers)
34% identity, 44% coverage: 206:378/392 of query aligns to 180:372/379 of O34002
Sites not aligning to the query:
1ixeA Crystal structure of citrate synthase from thermus thermophilus hb8 (see paper)
33% identity, 56% coverage: 160:380/392 of query aligns to 114:361/371 of 1ixeA
2h12B Structure of acetobacter aceti citrate synthase complexed with oxaloacetate and carboxymethyldethia coenzyme a (cmx) (see paper)
32% identity, 45% coverage: 203:378/392 of query aligns to 217:414/426 of 2h12B
1iomA Crystal structure of citrate synthase from thermus thermophilus hb8 (see paper)
32% identity, 56% coverage: 160:380/392 of query aligns to 114:364/374 of 1iomA
>CCNA_03758 FitnessBrowser__Caulo:CCNA_03758
MTDWMDAEQVLERLGIRPQTLYAYVSRGRIEAAAHPSDPRRSLYRASDVTALARKKARGR
RVADVAAEAIAWGEPVLPSAITTVSGGKLWYRGEDAAGLADQGLTLENVARLLRGGHGAA
LKASSRPPPPATDSARSRMFLTLAERAGREPPARGRAPLALAMEAADLLDAIVDAATGQA
GDGPAHQRFAHAWNLTADGADLVRRALVLMADHELNASTFAARVAASTGASLSAACLAGL
SALSGPLHGGMAARVEALVEEADRRDAARAVSSRLEQGASLPGFDHPLYPGGDPRAAALL
ARFEPPEPLTALWQATRAATGLAPNIDFALVALARGLALPQDAPFILFATARSAGWTAHA
IEQLQTGRLIRPRARYIGTVPSAAGYSPSSSS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory