Comparing DDA3937_RS06135 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
P69428 Sec-independent protein translocase protein TatA from Escherichia coli (strain K12) (see paper)
63% identity, 81% coverage: 1:56/69 of query aligns to 1:56/89 of P69428
>DDA3937_RS06135
MEGISIAKLLVIGALIVLLFGTNKLRSLGSDLGAAIKGFKKSMSDEQPAAKSSAQDEHPA
AISENRPKE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory