SitesBLAST
Comparing Dsui_0083 FitnessBrowser__PS:Dsui_0083 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2gnaA Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-gal (see paper)
55% identity, 97% coverage: 1:322/332 of query aligns to 3:329/329 of 2gnaA
- binding galactose-uridine-5'-diphosphate: K87 (= K86), S176 (= S175), V177 (= V176), T195 (= T192), M199 (= M196), R201 (= R198), M235 (≠ V232), R254 (= R251), E257 (= E254)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G11), T15 (= T13), G16 (= G14), S17 (= S15), F18 (= F16), S39 (= S37), R40 (= R38), D41 (= D39), K44 (= K42), D63 (= D62), V64 (= V63), A83 (= A82), A84 (= A83), A85 (= A84), K87 (= K86), L125 (= L124), S126 (= S125), Y137 (= Y136), K141 (= K140), Y167 (= Y166), G168 (= G167), V170 (= V169)
2gn9A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-glc (see paper)
55% identity, 97% coverage: 1:322/332 of query aligns to 3:329/329 of 2gn9A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G11), T15 (= T13), G16 (= G14), S17 (= S15), F18 (= F16), R40 (= R38), D41 (= D39), K44 (= K42), D63 (= D62), V64 (= V63), A83 (= A82), A84 (= A83), A85 (= A84), K87 (= K86), L125 (= L124), S126 (= S125), K141 (= K140), Y167 (= Y166), G168 (= G167), V170 (= V169), R174 (= R173)
- binding uridine-5'-diphosphate-glucose: K87 (= K86), T127 (= T126), K129 (= K128), Y137 (= Y136), N169 (= N168), S176 (= S175), V177 (= V176), P193 (= P190), T195 (= T192), M199 (= M196), R201 (= R198), M235 (≠ V232), R254 (= R251), E257 (= E254)
2gn6A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-glcnac (see paper)
55% identity, 97% coverage: 1:322/332 of query aligns to 3:329/329 of 2gn6A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G11), T15 (= T13), G16 (= G14), S17 (= S15), F18 (= F16), R40 (= R38), D41 (= D39), K44 (= K42), D63 (= D62), V64 (= V63), A84 (= A83), A85 (= A84), K87 (= K86), S126 (= S125), Y137 (= Y136), K141 (= K140), Y167 (= Y166), G168 (= G167), V170 (= V169), S173 (= S172), R174 (= R173)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K86), D128 (= D127), K129 (= K128), N169 (= N168), G175 (= G174), S176 (= S175), V177 (= V176), P193 (= P190), I194 (= I191), M199 (= M196), R201 (= R198), M235 (≠ V232), R254 (= R251), E257 (= E254)
2gn4A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADPH and udp-glcnac (see paper)
55% identity, 97% coverage: 1:322/332 of query aligns to 3:329/329 of 2gn4A
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G13 (= G11), T15 (= T13), G16 (= G14), S17 (= S15), F18 (= F16), S39 (= S37), R40 (= R38), D41 (= D39), K44 (= K42), D63 (= D62), V64 (= V63), A83 (= A82), A84 (= A83), A85 (= A84), K87 (= K86), T102 (= T101), L125 (= L124), S126 (= S125), T127 (= T126), Y137 (= Y136), K141 (= K140), Y167 (= Y166), G168 (= G167), V170 (= V169), S173 (= S172), R174 (= R173)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K86), T127 (= T126), D128 (= D127), K129 (= K128), Y137 (= Y136), N169 (= N168), S176 (= S175), V177 (= V176), P193 (= P190), T195 (= T192), M199 (= M196), R201 (= R198), M235 (≠ V232), R254 (= R251), E257 (= E254)
2gn8A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp (see paper)
55% identity, 97% coverage: 1:322/332 of query aligns to 1:327/327 of 2gn8A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G11), T13 (= T13), G14 (= G14), S15 (= S15), F16 (= F16), S37 (= S37), R38 (= R38), D39 (= D39), K42 (= K42), D61 (= D62), V62 (= V63), A81 (= A82), A82 (= A83), A83 (= A84), K85 (= K86), T100 (= T101), L123 (= L124), S124 (= S125), K139 (= K140), Y165 (= Y166), G166 (= G167), V168 (= V169), S171 (= S172), R172 (= R173)
- binding uridine-5'-diphosphate: K127 (= K128), N167 (= N168), V175 (= V176), P191 (= P190), I192 (= I191), T193 (= T192), M197 (= M196), R199 (= R198), M233 (≠ V232), R252 (= R251)
O25511 UDP-N-acetylglucosamine 4,6-dehydratase (inverting); Pseudaminic acid biosynthesis protein B; UDP-GlcNAc-inverting 4,6-dehydratase; EC 4.2.1.115 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
55% identity, 97% coverage: 1:322/332 of query aligns to 7:333/333 of O25511
3w1vA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in complex with inihibitor (see paper)
43% identity, 95% coverage: 7:322/332 of query aligns to 16:333/347 of 3w1vA
- binding [(2R,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,4-bis(oxidanyl)oxan-2-yl]methylimino-azanylidene-azanium: K93 (= K86), Q94 (≠ I87), N175 (= N168), S179 (= S172), R180 (= R173), S182 (= S175), V183 (= V176), L186 (≠ F179), T198 (≠ P190), I199 (= I191), T200 (= T192), M204 (= M196), R206 (= R198), V240 (= V232), R263 (= R251), E266 (= E254)
4g5hA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in complex with by-product (see paper)
43% identity, 95% coverage: 7:322/332 of query aligns to 16:333/346 of 4g5hA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G11), T22 (= T13), G23 (= G14), S24 (= S15), F25 (= F16), S45 (= S37), R46 (= R38), D47 (= D39), K50 (= K42), D69 (= D62), V70 (= V63), A89 (= A82), A90 (= A83), A91 (= A84), K93 (= K86), L131 (= L124), T133 (= T126), K147 (= K140), Y173 (= Y166)
- binding [(2R,3R,4R,6R)-3-acetamido-6-methyl-4-oxidanyl-5-oxidanylidene-oxan-2-yl] [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] hydrogen phosphate: Q94 (≠ I87), V95 (= V88), K135 (= K128), N175 (= N168), S182 (= S175), V183 (= V176), L186 (≠ F179), T198 (≠ P190), T200 (= T192), M204 (= M196), V240 (= V232), R263 (= R251), E266 (= E254), Y278 (≠ A266), S313 (≠ G301), Y314 (≠ F302), E315 (≠ S303), Y316 (= Y304), N320 (= N309)
6bwcC X-ray structure of pen from bacillus thuringiensis (see paper)
39% identity, 97% coverage: 6:327/332 of query aligns to 7:324/327 of 6bwcC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G11), T14 (= T13), G15 (= G14), T16 (≠ S15), I17 (≠ F16), S37 (= S37), R38 (= R38), S39 (≠ D39), D63 (= D62), I64 (≠ V63), V83 (≠ A82), A84 (= A83), K87 (= K86), T125 (≠ L124), S127 (≠ T126), Y137 (= Y136), K141 (= K140), F167 (≠ Y166), V170 (= V169), S173 (= S172), R174 (= R173)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K86), H88 (≠ I87), S127 (≠ T126), N128 (≠ D127), Y137 (= Y136), N169 (= N168), S176 (= S175), V177 (= V176), L180 (≠ F179), T192 (≠ P190), T194 (= T192), M198 (= M196), R200 (= R198), L234 (≠ V232), E265 (= E254)
4j2oC Crystal structure of NADP-bound wbjb from a. Baumannii community strain d1279779 (see paper)
44% identity, 86% coverage: 1:286/332 of query aligns to 1:289/316 of 4j2oC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G11), T13 (= T13), G14 (= G14), S15 (= S15), F16 (= F16), S36 (= S37), R37 (= R38), D38 (= D39), K41 (= K42), D60 (= D62), V61 (= V63), A80 (= A82), A81 (= A83), A82 (= A84), K84 (= K86), T99 (= T101), L122 (= L124), K138 (= K140), Y164 (= Y166)
3vvcA Crystal structure of capsular polysaccharide synthesizing enzyme cape , k126e, in apo form (see paper)
43% identity, 95% coverage: 7:322/332 of query aligns to 8:305/318 of 3vvcA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G11), T14 (= T13), G15 (= G14), F17 (= F16), S37 (= S37), R38 (= R38), D39 (= D39), K42 (= K42), D61 (= D62), V62 (= V63), R63 (= R64), A81 (= A82), A82 (= A83), A83 (= A84), K85 (= K86), S124 (= S125), T125 (= T126), K139 (= K140), Y165 (= Y166), G166 (= G167)
3vvbA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in apo form (see paper)
37% identity, 95% coverage: 7:322/332 of query aligns to 6:260/270 of 3vvbA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G11), T12 (= T13), G13 (= G14), S14 (= S15), F15 (= F16), S35 (= S37), R36 (= R38), D37 (= D39), K40 (= K42), D59 (= D62), V60 (= V63), A80 (= A83), A81 (= A84), K83 (= K86), L121 (= L124), T123 (= T126), K137 (= K140), Y163 (= Y166), G164 (= G167)
4tqgA Crystal structure of megavirus udp-glcnac 4,6-dehydratase, 5-epimerase mg534 (see paper)
32% identity, 84% coverage: 2:281/332 of query aligns to 3:266/297 of 4tqgA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G11), S14 (≠ T13), G15 (= G14), S16 (= S15), L17 (≠ F16), R36 (= R38), D37 (= D39), D59 (= D62), I60 (≠ V63), A81 (= A82), A82 (= A83), A83 (= A84), K85 (= K86), V128 (≠ L124), Y140 (= Y136), K144 (= K140), Y168 (= Y166), G169 (= G167), V171 (= V169)
5bjuA X-ray structure of the pglf dehydratase from campylobacter jejuni in complex with udp and NAD(h) (see paper)
31% identity, 81% coverage: 2:271/332 of query aligns to 22:297/340 of 5bjuA
- binding nicotinamide-adenine-dinucleotide: G31 (= G11), G34 (= G14), T35 (≠ S15), I36 (≠ F16), D56 (≠ S37), H57 (≠ R38), S82 (≠ D62), I83 (≠ V63), A104 (= A82), A105 (= A83), A106 (= A84), K108 (= K86), N123 (≠ T101), I146 (≠ L124), K162 (= K140), F184 (≠ Y166), G185 (= G167), N186 (= N168), V187 (= V169), S190 (= S172), S191 (≠ R173)
- binding uridine-5'-diphosphate: K150 (= K128), N186 (= N168), S193 (= S175), V194 (= V176), T209 (≠ P190), L210 (≠ I191), T211 (= T192), I215 (≠ M196), R217 (= R198), E279 (= E254)
5bjvA X-ray structure of the pglf udp-n-acetylglucosamine 4,6-dehydratase from campylobacterjejuni, d396n/k397a variant in complex with udp-n- acrtylglucosamine (see paper)
30% identity, 81% coverage: 2:271/332 of query aligns to 22:297/339 of 5bjvA
- binding nicotinamide-adenine-dinucleotide: G31 (= G11), G34 (= G14), T35 (≠ S15), I36 (≠ F16), D56 (≠ S37), H57 (≠ R38), S82 (≠ D62), I83 (≠ V63), A104 (= A82), A105 (= A83), A106 (= A84), K108 (= K86), N123 (≠ T101), I146 (≠ L124), K162 (= K140), F184 (≠ Y166), G185 (= G167), N186 (= N168), V187 (= V169), S190 (= S172), S191 (≠ R173)
- binding uridine-diphosphate-n-acetylglucosamine: K108 (= K86), H109 (≠ I87), T148 (= T126), G185 (= G167), N186 (= N168), S193 (= S175), V194 (= V176), T209 (≠ P190), L210 (≠ I191), T211 (= T192), I215 (≠ M196), R217 (= R198), R276 (= R251), E279 (= E254)
1r66A Crystal structure of desiv (dtdp-glucose 4,6-dehydratase) from streptomyces venezuelae with NAD and tyd bound (see paper)
31% identity, 56% coverage: 7:191/332 of query aligns to 3:207/322 of 1r66A
- active site: T127 (= T126), D128 (= D127), E129 (≠ K128), Y151 (= Y136), K155 (= K140)
- binding nicotinamide-adenine-dinucleotide: G10 (= G14), F11 (≠ S15), I12 (≠ F16), D37 (≠ F36), S38 (= S37), L39 (≠ R38), T40 (≠ D39), G43 (≠ K42), D63 (= D62), I64 (≠ V63), F83 (≠ A82), A84 (= A83), A85 (= A84), S87 (≠ K86), T102 (= T101), V125 (≠ L124), S126 (= S125), Y151 (= Y136), K155 (= K140), N181 (≠ V169)
- binding thymidine-5'-diphosphate: H88 (≠ I87), E129 (≠ K128), N180 (= N168), K190 (≠ S175), L191 (≠ V176), P206 (= P190)
Sites not aligning to the query:
1r6dA Crystal structure of desiv double mutant (dtdp-glucose 4,6- dehydratase) from streptomyces venezuelae with NAD and dau bound (see paper)
29% identity, 65% coverage: 7:223/332 of query aligns to 3:240/322 of 1r6dA
- active site: T127 (= T126), N128 (≠ D127), Q129 (≠ K128), Y151 (= Y136), K155 (= K140)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S87 (≠ K86), H88 (≠ I87), T127 (= T126), N128 (≠ D127), Q129 (≠ K128), Y151 (= Y136), N180 (= N168), K190 (≠ S175), L191 (≠ V176), P206 (= P190), Y208 (vs. gap), R215 (= R198)
- binding nicotinamide-adenine-dinucleotide: G10 (= G14), F11 (≠ S15), I12 (≠ F16), D37 (≠ F36), S38 (= S37), L39 (≠ R38), T40 (≠ D39), A42 (≠ M41), G43 (≠ K42), D63 (= D62), I64 (≠ V63), F83 (≠ A82), A84 (= A83), A85 (= A84), S87 (≠ K86), T102 (= T101), V125 (≠ L124), S126 (= S125), Y151 (= Y136), K155 (= K140), N181 (≠ V169)
Sites not aligning to the query:
Q9SYM5 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1; Protein REPRESSOR OF LRX1 1; Rhamnose biosynthetic enzyme 1; AtRHM1; EC 4.2.1.76; EC 1.1.1.-; EC 5.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
27% identity, 75% coverage: 3:252/332 of query aligns to 5:284/669 of Q9SYM5
- R283 (= R251) mutation to K: In rol1-2; Abolishes dehydratase activity in vitro (PubMed:16766693). Induces aberrant accumulation of flavonols leading to alterations in plant growth and cell shape formation (PubMed:18567791, PubMed:18757557).
3pvzA Udp-n-acetylglucosamine 4,6-dehydratase from vibrio fischeri
26% identity, 86% coverage: 1:285/332 of query aligns to 27:302/372 of 3pvzA
- binding nicotinamide-adenine-dinucleotide: G40 (= G14), S41 (= S15), I42 (≠ F16), D62 (≠ S37), I63 (≠ R38), D92 (≠ F59), I93 (= I60), L114 (≠ A82), S115 (≠ A83), A116 (= A84), K118 (= K86), V158 (≠ L124), D161 (= D127), K174 (= K140), V198 (= V169), S201 (= S172)
3pvzB Udp-n-acetylglucosamine 4,6-dehydratase from vibrio fischeri
28% identity, 58% coverage: 1:191/332 of query aligns to 25:224/300 of 3pvzB
- binding nicotinamide-adenine-dinucleotide: G38 (= G14), S39 (= S15), I40 (≠ F16), D60 (≠ S37), I61 (≠ R38), L89 (≠ F58), D90 (≠ F59), I91 (= I60), L112 (≠ A82), S113 (≠ A83), A114 (= A84), K116 (= K86), D159 (= D127), K172 (= K140), N195 (≠ V163), V196 (= V164), S199 (≠ G167)
Query Sequence
>Dsui_0083 FitnessBrowser__PS:Dsui_0083
MLTNTSILITGGTGSFGNTFVPMTLAKFNPKKIVIFSRDEMKQWEMAKKFGGDERVRFFI
GDVRDRERLYRALDGIDYVVHAAATKIVPTAEYNPFECVKTNINGAMNLIDACIDKGVKR
VVALSTDKASSPVNLYGATKLASDKLFVAGNSYAGGHDTRFAVVRYGNVMGSRGSVIPFF
MSIKDKGVLPITDERMTRFMISLEQGVELVWHAFGDMEGGEIYVKKIPSMKVTDLARAIA
PNASLEYVGIRPGEKLHEQMISEEDALYSYEYPEHFKILPAIHNWHLSPGRIKDGKKVPE
GFSYTSDNNSEWMGIEELQRWIAINQEKIGNI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory