Comparing Dsui_0094 FitnessBrowser__PS:Dsui_0094 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
6n2oC 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound (see paper)
26% identity, 95% coverage: 8:202/205 of query aligns to 7:185/572 of 6n2oC
Sites not aligning to the query:
6n2oA 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound (see paper)
26% identity, 95% coverage: 8:202/205 of query aligns to 7:185/572 of 6n2oA
Sites not aligning to the query:
6n2nA Crystal structure of 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus (see paper)
26% identity, 95% coverage: 8:202/205 of query aligns to 7:185/572 of 6n2nA
Sites not aligning to the query:
>Dsui_0094 FitnessBrowser__PS:Dsui_0094
MSIATTNILVVGIGGQGVMTATEILAEAAIALGHDVKKTEVAGMAQRGGVVSSHLRFGPK
VLSPQITPGTAHVLLGFEAAEAMRWRHMLVPEGIALMNTAQLTPPVVDLGLYDYPADPVG
SMKDSGCRVVAFDAMAIAKDLGDIRLGNTVMLGAVADHLPFSADILLNCILQRFARKGEK
VVEQNRKAFAAGRAAVAATAEAALA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory